| UniProt ID | PFD2_YEAST | |
|---|---|---|
| UniProt AC | P40005 | |
| Protein Name | Prefoldin subunit 2 | |
| Gene Name | GIM4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 111 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.. | |
| Protein Sequence | MEQRNNVFQAKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGALVESDVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKIQVVKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Ubiquitination | RNNVFQAKYNEYKQI CCCHHHHHHHHHHHH | 37.51 | 22817900 | |
| 11 | Acetylation | RNNVFQAKYNEYKQI CCCHHHHHHHHHHHH | 37.51 | 24489116 | |
| 16 | Ubiquitination | QAKYNEYKQILEELQ HHHHHHHHHHHHHHH | 25.36 | 23749301 | |
| 16 | Acetylation | QAKYNEYKQILEELQ HHHHHHHHHHHHHHH | 25.36 | 24489116 | |
| 33 | Acetylation | IIELGHDKDEHTIVI HHHCCCCCCCCEEEE | 60.38 | 24489116 | |
| 76 | Ubiquitination | LPILETKKENIEGTI CCHHHHCHHHCCHHH | 64.51 | 23749301 | |
| 85 | Ubiquitination | NIEGTISKMKETLIQ HCCHHHHHHHHHHHH | 50.57 | 22817900 | |
| 87 | Ubiquitination | EGTISKMKETLIQTA CHHHHHHHHHHHHHH | 51.81 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
