| UniProt ID | MMS2_YEAST | |
|---|---|---|
| UniProt AC | P53152 | |
| Protein Name | Ubiquitin-conjugating enzyme variant MMS2 | |
| Gene Name | MMS2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 137 | |
| Subcellular Localization | ||
| Protein Description | Has a role in the DNA error-free postreplication repair (PRR) pathway. Lacks catalytic activity by itself. The UBC13/MMS2 heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'.. | |
| Protein Sequence | MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATPANKKLRQPKEGETF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Acetylation | RLLEELEKGEKGFGP HHHHHHHCCCCCCCC | 82.23 | 24489116 | |
| 58 | Phosphorylation | SNHENRIYSLSIDCG CCCCCCEEEEEEECC | 10.58 | 27017623 | |
| 59 | Phosphorylation | NHENRIYSLSIDCGP CCCCCEEEEEEECCC | 17.17 | 27017623 | |
| 71 | Phosphorylation | CGPNYPDSPPKVTFI CCCCCCCCCCEEEEE | 38.30 | 28889911 | |
| 89 | Phosphorylation | NLPCVNPTTGEVQTD CCCEECCCCCCEECC | 42.08 | 22369663 | |
| 90 | Phosphorylation | LPCVNPTTGEVQTDF CCEECCCCCCEECCH | 32.38 | 22369663 | |
| 95 | Phosphorylation | PTTGEVQTDFHTLRD CCCCCEECCHHHHHH | 45.89 | 22369663 | |
| 99 | Phosphorylation | EVQTDFHTLRDWKRA CEECCHHHHHHHHHH | 24.39 | 22369663 | |
| 107 | Phosphorylation | LRDWKRAYTMETLLL HHHHHHHCHHHHHHH | 15.62 | 22890988 | |
| 108 | Phosphorylation | RDWKRAYTMETLLLD HHHHHHCHHHHHHHH | 13.93 | 22890988 | |
| 111 | Phosphorylation | KRAYTMETLLLDLRK HHHCHHHHHHHHHHH | 16.34 | 22890988 | |
| 132 | Ubiquitination | NKKLRQPKEGETF-- HHHCCCCCCCCCC-- | 70.75 | 22106047 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MMS2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MMS2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MMS2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-71, AND MASSSPECTROMETRY. | |
