| UniProt ID | SHU1_YEAST | |
|---|---|---|
| UniProt AC | P38751 | |
| Protein Name | Suppressor of HU sensitivity involved in recombination protein 1 | |
| Gene Name | SHU1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 150 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Plays a role in a RAD51/RAD54-dependent homologous recombination repair (HRR) pathway to repair MMS-induced lesions during S-phase.. | |
| Protein Sequence | MQFEERLQQLVESDWSLDQSSPNVLVIVLGDTARKYVELGGLKEHVTTNTVAGHVASRERVSVVFLGRVKYLYMYLTRMQAQANGPQYSNVLVYGLWDLTATQDGPQQLRLLSLVLRQCLSLPSKVEFYPEPPSSSVPARLLRFWDHIIR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SHU1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHU1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHU1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHU1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HDA1_YEAST | HDA1 | physical | 10688190 | |
| SHU2_YEAST | SHU2 | physical | 10688190 | |
| SHU2_YEAST | SHU2 | physical | 15654096 | |
| PSY3_YEAST | PSY3 | physical | 15654096 | |
| CSM2_YEAST | CSM2 | physical | 15654096 | |
| SHU2_YEAST | SHU2 | physical | 11283351 | |
| CP51_YEAST | ERG11 | physical | 18467557 | |
| PSY3_YEAST | PSY3 | physical | 18719252 | |
| RAD5_YEAST | RAD5 | genetic | 20444977 | |
| SGS1_YEAST | SGS1 | genetic | 21741981 | |
| PSY3_YEAST | PSY3 | genetic | 17206143 | |
| CSM2_YEAST | CSM2 | genetic | 17206143 | |
| SHU2_YEAST | SHU2 | genetic | 17206143 | |
| CLA4_YEAST | CLA4 | genetic | 17206143 | |
| CSM2_YEAST | CSM2 | physical | 23575680 | |
| SHU2_YEAST | SHU2 | physical | 23575680 | |
| PSY3_YEAST | PSY3 | physical | 23575680 | |
| RPN5_YEAST | RPN5 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| MOB1_YEAST | MOB1 | genetic | 27708008 | |
| NU192_YEAST | NUP192 | genetic | 27708008 | |
| KTHY_YEAST | CDC8 | genetic | 27708008 | |
| SEC22_YEAST | SEC22 | genetic | 27708008 | |
| ROT1_YEAST | ROT1 | genetic | 27708008 | |
| HRR25_YEAST | HRR25 | genetic | 27708008 | |
| SHU2_YEAST | SHU2 | physical | 29069504 | |
| PSY3_YEAST | PSY3 | physical | 29069504 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
