| UniProt ID | PSY3_YEAST | |
|---|---|---|
| UniProt AC | Q12318 | |
| Protein Name | Platinum sensitivity protein 3 | |
| Gene Name | PSY3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 242 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required for resistance to the DNA-damaging agents methyl methanesulfonate (MMS), cisplatin and oxaliplatin, but not to mitomycin C. Plays a role in protection against mutation accumulation. May be a component of the recombination-repair pathway.. | |
| Protein Sequence | MEVLKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVDNFNFQLRGIVIDNLSFLNFESDKNYDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVDKWSIKRKSGVTLYPTKLPDSYMKGMDLIIYREVVDGRPQYRRIAALEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 202 | Phosphorylation | KWSIKRKSGVTLYPT CCCEECCCCCEEEEC | 42.39 | 28889911 | |
| 205 | Phosphorylation | IKRKSGVTLYPTKLP EECCCCCEEEECCCC | 24.89 | 19779198 | |
| 215 | Phosphorylation | PTKLPDSYMKGMDLI ECCCCCHHHCCCEEE | 15.38 | 19779198 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSY3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSY3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSY3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...