| UniProt ID | HMX1_YEAST | |
|---|---|---|
| UniProt AC | P32339 | |
| Protein Name | Heme-binding protein HMX1 | |
| Gene Name | HMX1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 317 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type IV membrane protein . |
|
| Protein Description | Plays an important role in the degradation of heme under conditions of iron deprivation.. | |
| Protein Sequence | MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVLYFLVKSFLSIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 32 | Ubiquitination | QTRDAHNKINTFMGI CCHHHHHHHHHHHHH | 27.71 | 17644757 | |
| 40 | Ubiquitination | INTFMGIKMAIAMRH HHHHHHHHHHHHHHC | 19.29 | 17644757 | |
| 89 | Ubiquitination | LQTSTILKQFWLEDF HHHHHHHHHHHHHHH | 39.33 | 17644757 | |
| 104 | Ubiquitination | RRSTQIYKDLKLLYS HHHHHHHHHHHHHHC | 59.21 | 17644757 | |
| 107 | Ubiquitination | TQIYKDLKLLYSNTF HHHHHHHHHHHCCCC | 46.72 | 17644757 | |
| 115 | Ubiquitination | LLYSNTFKSTESLNE HHHCCCCCCHHHHHH | 55.20 | 17644757 | |
| 185 | Ubiquitination | GLFPNFEKLSQKELV CCCCCHHHHCHHHHH | 49.66 | 24961812 | |
| 193 | Ubiquitination | LSQKELVKKGTNFFT HCHHHHHHCCCCCEE | 59.10 | 17644757 | |
| 194 | Ubiquitination | SQKELVKKGTNFFTF CHHHHHHCCCCCEEH | 64.59 | 24961812 | |
| 213 | Ubiquitination | PTEETRLKWEYKKNY CCHHHHHHHHHHHHH | 34.39 | 17644757 | |
| 218 | Ubiquitination | RLKWEYKKNYELATR HHHHHHHHHHHCCCC | 64.95 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HMX1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HMX1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HMX1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
