UniProt ID | CWP2_YEAST | |
---|---|---|
UniProt AC | P43497 | |
Protein Name | Cell wall protein CWP2 | |
Gene Name | CWP2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 92 | |
Subcellular Localization |
Secreted, cell wall. Membrane Lipid-anchor, GPI-anchor. Covalently-linked GPI-modified cell wall protein (GPI-CWP) found in young daughter cells. |
|
Protein Description | Component of the cell wall.. | |
Protein Sequence | MQFSTVASVAFVALANFVAAESAAAISQITDGQIQATTTATTEATTTAAPSSTVETVSPSSTETISQQTENGAAKAAVGMGAGALAAAAMLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
71 | GPI-anchor | TISQQTENGAAKAAV CHHHHCCCCHHHHHH | 49.11 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWP2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWP2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWP2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
T2EA_YEAST | TFA1 | physical | 16554755 | |
ALO_YEAST | ALO1 | physical | 18467557 | |
MNN11_YEAST | MNN11 | genetic | 23891562 | |
GAS1_YEAST | GAS1 | genetic | 23891562 | |
SRO7_YEAST | SRO7 | genetic | 23891562 | |
YCQ6_YEAST | YCR016W | genetic | 27708008 | |
FMP45_YEAST | FMP45 | genetic | 27708008 | |
GIR2_YEAST | GIR2 | genetic | 27708008 | |
KIN3_YEAST | KIN3 | genetic | 27708008 | |
DPB3_YEAST | DPB3 | genetic | 27708008 | |
RER1_YEAST | RER1 | genetic | 27708008 | |
RNQ1_YEAST | RNQ1 | genetic | 27708008 | |
YCV1_YEAST | YCR061W | genetic | 27708008 | |
CYPR_YEAST | CPR4 | genetic | 27708008 | |
OST4_YEAST | OST4 | genetic | 27708008 | |
SPO71_YEAST | SPO71 | genetic | 27708008 | |
RKM2_YEAST | RKM2 | genetic | 27708008 | |
UME6_YEAST | UME6 | genetic | 27708008 | |
RTN1_YEAST | RTN1 | genetic | 27708008 | |
ALK1_YEAST | ALK1 | genetic | 27708008 | |
VPS73_YEAST | VPS73 | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
GAS1_YEAST | GAS1 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
VAM10_YEAST | VAM10 | genetic | 27708008 | |
MTHR1_YEAST | MET12 | genetic | 27708008 | |
YME1_YEAST | YME1 | genetic | 27708008 | |
UBQL1_HUMAN | UBQLN1 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...