| UniProt ID | OST4_YEAST | |
|---|---|---|
| UniProt AC | Q99380 | |
| Protein Name | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4 | |
| Gene Name | OST4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 36 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type III membrane protein. |
|
| Protein Description | Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. OST4 is required for recruitment of OST3 or OST6 to the OST complex. It is essential for cell growth at 37 but not at 25 degrees Celsius.. | |
| Protein Sequence | MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Phosphorylation | TFGIVMMTLIVIYHA HHHHHHHHHHHHHHH | 8.67 | 28889911 | |
| 25 | Phosphorylation | MMTLIVIYHAVDSTM HHHHHHHHHHHHHCC | 3.47 | 28889911 | |
| 30 | Phosphorylation | VIYHAVDSTMSPKN- HHHHHHHHCCCCCC- | 21.29 | 28889911 | |
| 33 | Phosphorylation | HAVDSTMSPKN---- HHHHHCCCCCC---- | 32.58 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OST4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OST4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OST4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
