| UniProt ID | OST1_YEAST | |
|---|---|---|
| UniProt AC | P41543 | |
| Protein Name | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 | |
| Gene Name | OST1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 476 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. |
|
| Protein Description | Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.. | |
| Protein Sequence | MRQVWFSWIVGLFLCFFNVSSAAQYEPPATWENVDYKRTIDVSNAYISETIEITIKNIASEPATEYFTAFESGIFSKVSFFSAYFTNEATFLNSQLLANSTTAPGDDGESEIRYGIIQFPNAISPQEEVSLVIKSFYNTVGIPYPEHVGMSEEQHLLWETNRLPLSAYDTKKASFTLIGSSSFEEYHPPNDESLLGKANGNSFEFGPWEDIPRFSSNETLAIVYSHNAPLNQVVNLRRDIWLSHWASTIQFEEYYELTNKAAKLSKGFSRLELMKQIQTQNMRQTHFVTVLDMLLPEGATDHYFTDLVGLVSTSHAERDHFFIRPRFPIFGGWNYNFTVGWTNKLSDFLHVSSGSDEKFVASIPILNGPPDTVYDNVELSVFLPEGAEIFDIDSPVPFTNVSIETQKSYFDLNKGHVKLTFSYRNLISQVANGQVLIKYDYPKSSFFKKPLSIACYIFTALMGVFVLKTLNMNVTN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | N-linked_Glycosylation | GLFLCFFNVSSAAQY HHHHHHHCCCCCHHC | 16.71 | - | |
| 72 | Phosphorylation | EYFTAFESGIFSKVS HHHHHHHCCCCCCCC | 30.64 | 27717283 | |
| 99 | N-linked_Glycosylation | LNSQLLANSTTAPGD HCCEEECCCCCCCCC | 39.60 | - | |
| 171 | Succinylation | PLSAYDTKKASFTLI CCCHHHCCCCEEEEE | 43.36 | 23954790 | |
| 174 | Phosphorylation | AYDTKKASFTLIGSS HHHCCCCEEEEECCC | 27.87 | 27017623 | |
| 217 | N-linked_Glycosylation | DIPRFSSNETLAIVY HCCCCCCCCEEEEEE | 45.11 | - | |
| 260 | Acetylation | EYYELTNKAAKLSKG HHHHHHHHHHHHHCC | 44.48 | 25381059 | |
| 275 | Ubiquitination | FSRLELMKQIQTQNM CCHHHHHHHHHHHCC | 57.80 | 23749301 | |
| 336 | N-linked_Glycosylation | IFGGWNYNFTVGWTN CCCCCCEEEEEECCC | 23.93 | 29301962 | |
| 400 | N-linked_Glycosylation | DSPVPFTNVSIETQK CCCCCCCEEEEEEEC | 26.39 | 29301962 | |
| 414 | Acetylation | KSYFDLNKGHVKLTF CCEEECCCCEEEEEE | 58.66 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OST1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OST1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OST1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
