| UniProt ID | ALG5_YEAST | |
|---|---|---|
| UniProt AC | P40350 | |
| Protein Name | Dolichyl-phosphate beta-glucosyltransferase | |
| Gene Name | ALG5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 334 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein. Its interaction with the substrate UDP-glucose may occur at the cytoplasmic side of the ER, whereas the steps utilizing dolichyl beta-D-glucosyl phosphate take place in the lumen o |
|
| Protein Description | ||
| Protein Sequence | MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 53 | Acetylation | KYIAIDEKGHEVSRA CEEEECCCCHHHHHH | 62.92 | 24489116 | |
| 83 | N-linked_Glycosylation | SVVIPSYNETGRILL EEECCCCCCHHHHHH | 44.70 | - | |
| 119 | N-linked_Glycosylation | VDDGSTDNTTQYCLK EECCCCCHHHHHHHH | 45.15 | - | |
| 133 | Acetylation | KICKEQFKLNYEQFR HHHHHHHCCCHHHHE | 35.20 | 24489116 | |
| 176 | Acetylation | ADADGASKFSDVEKL ECCCCCCCCHHHHHH | 48.64 | 24489116 | |
| 182 | Acetylation | SKFSDVEKLIDAISK CCCHHHHHHHHHHHH | 51.06 | 24489116 | |
| 198 | Ubiquitination | ETSSTDLKTTKPAVA CCCCCCCCCCCCEEE | 57.89 | 23749301 | |
| 201 | Ubiquitination | STDLKTTKPAVAIGS CCCCCCCCCEEEECC | 35.89 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALG5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALG5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALG5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
