| UniProt ID | SPC3_YEAST | |
|---|---|---|
| UniProt AC | Q12133 | |
| Protein Name | Signal peptidase complex subunit SPC3 | |
| Gene Name | SPC3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 184 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein . |
|
| Protein Description | Component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum. SPC3 is required for signal peptidase activity and is essential for viability.. | |
| Protein Sequence | MFSFVQRFQNVSNQAFSMGIVMVVFIMASSYYQLINNNAFSVPSNIDNVKTLINVRTSRYFGSQRGKAKENMKIKFDLNTDLTPLFNWNTKQVFVYLTAEYNSTEKITSEVTFWDKIIKSKDDAVIDVNDLRSKYSIWDIEDGKFEGKDLVFKLHWNVQPWVGLLTYGETVGNYTLTVENKNKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 102 | N-linked_Glycosylation | VYLTAEYNSTEKITS EEEEEECCCCCCEEE | 33.68 | - | |
| 119 | 2-Hydroxyisobutyrylation | TFWDKIIKSKDDAVI EHHHHHHCCCCCEEE | 55.73 | - | |
| 121 | Acetylation | WDKIIKSKDDAVIDV HHHHHCCCCCEEEEH | 55.41 | 24489116 | |
| 134 | Acetylation | DVNDLRSKYSIWDIE EHHHHHHCEEEEECC | 36.26 | 24489116 | |
| 144 | Acetylation | IWDIEDGKFEGKDLV EEECCCCEEECEEEE | 53.19 | 24489116 | |
| 173 | N-linked_Glycosylation | TYGETVGNYTLTVEN ECCEEECEEEEEEEC | 23.45 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPC3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPC3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPC3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
