UniProt ID | ATG15_YEAST | |
---|---|---|
UniProt AC | P25641 | |
Protein Name | Putative lipase ATG15 | |
Gene Name | ATG15 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 520 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein. Golgi apparatus membrane Single-pass type II membrane protein. Endosome, multivesicular body membrane Single-pass type II membrane protein. Prevacuolar compartment membrane Single-pa |
|
Protein Description | Lipase which is essential for lysis of subvacuolar cytoplasm to vacuole targeted bodies and intravacuolar autophagic bodies. Involved in the lysis of intravacuolar multivesicular body (MVB) vesicles. The intravacuolar membrane disintegration by ATG15 is critical to life span extension.. | |
Protein Sequence | MLHKSPSRKRFASPLHLGCILTLTVLCLIAYYFALPDYLSVGKSSSRGAMDQKSDGTFRLKSIYRHGVGANHRLHQRLEVTPEVISAAGMLYQETTTQGQDFEDQEPLWTTNAEYATTNPFDFEFELRRMPLLMKRMKERDPEFIESYIYGETYMTEEEEHAMWIDDDIVAPNITDRGTVVSLALMSSNAYVRIPQTGDWRNVTEPWNETEPEDFGWDGDGIRGHVFYNEVENIVVLSIKGTSAQGLPGSGEDETTGNDKINDNLLFSCCCARVSYLWTTVCDCYVKSYICDESCLEKELRRKDRFYSAVVDIYKGVLKEYPDAAIWVTGHSLGGALASLLGRTFGLPAVAFESPGELLPSKRLHLPFPPGLPSYMEGIWHFGHNADPIFMGTCNGASSSCSLVGYAMETACHTGRVCVYDVVNDKGWSVNMFNHRIHKVIDEVLLGYEQAAKCVEPEPCVDCYNWKFIPSRDWESSSRLITKTKSHAAPTTTTRTTATTTSSSTCVGRNWLGFCTKYEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
173 | N-linked_Glycosylation | DDDIVAPNITDRGTV CCCCCCCCCCCCCHH | 39.80 | - | |
202 | N-linked_Glycosylation | PQTGDWRNVTEPWNE CCCCCCCCCCCCCCC | 40.59 | - | |
208 | N-linked_Glycosylation | RNVTEPWNETEPEDF CCCCCCCCCCCCHHC | 57.96 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG15_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG15_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG15_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...