| UniProt ID | CYB5_YEAST | |
|---|---|---|
| UniProt AC | P40312 | |
| Protein Name | Cytochrome b5 | |
| Gene Name | CYB5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 120 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein Cytoplasmic side. Microsome membrane Single-pass membrane protein Cytoplasmic side. |
|
| Protein Description | Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. It plays a role in fatty-acid desaturation and is also involved in several steps of the sterol biosynthesis pathway, particularly in the 4-demethylation of the 4,4'-dimethyl zymosterol.. | |
| Protein Sequence | MPKVYSYQEVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEALRLLKGLYIGDVDKTSERVSVEKVSTSENQSKGSGTLVVILAILMLGVAYYLLNE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | Acetylation | DEALRLLKGLYIGDV HHHHHHHCCCEECCC | 52.00 | 24489116 | |
| 79 | Acetylation | LYIGDVDKTSERVSV CEECCCCCCCCEEEE | 54.52 | 24489116 | |
| 80 | Phosphorylation | YIGDVDKTSERVSVE EECCCCCCCCEEEEE | 31.21 | 27214570 | |
| 81 | Phosphorylation | IGDVDKTSERVSVEK ECCCCCCCCEEEEEE | 29.19 | 27214570 | |
| 85 | Phosphorylation | DKTSERVSVEKVSTS CCCCCEEEEEEEECC | 30.68 | 29136822 | |
| 91 | Phosphorylation | VSVEKVSTSENQSKG EEEEEEECCCCCCCC | 42.94 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYB5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYB5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYB5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
