| UniProt ID | AP1S1_YEAST | |
|---|---|---|
| UniProt AC | P35181 | |
| Protein Name | AP-1 complex subunit sigma-1 | |
| Gene Name | APS1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 156 | |
| Subcellular Localization | Cytoplasm . Nucleus . Cytoplasmic vesicle, clathrin-coated vesicle membrane . Endosome . Golgi apparatus . | |
| Protein Description | Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. AP19 is probably a subunit of the Golgi membrane adaptor.. | |
| Protein Sequence | MTQLKYLLLVSRQGKIRLKKWYTAMSAGEKAKIVKDLTPTILARKPKMCNIIEYNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFVETMDTYFGNVCELDIIFNFSKVYDILNEMIMCDGSIAESSRKEVLHHVTVMDTMESNDNLERVLS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Ubiquitination | GEKAKIVKDLTPTIL HHHCHHHHCCCHHHH | 50.96 | 23749301 | |
| 140 | Phosphorylation | KEVLHHVTVMDTMES HHHHHEEEEHHCCCC | 13.02 | 28889911 | |
| 144 | Phosphorylation | HHVTVMDTMESNDNL HEEEEHHCCCCCCCH | 12.54 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP1S1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP1S1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP1S1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
