dbPTM

CST26_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CST26_YEAST
UniProt AC	P38226
Protein Name	Uncharacterized acyltransferase CST26
Gene Name	CST26
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	397
Subcellular Localization	Lipid droplet . Membrane Multi-pass membrane protein .
Protein Description	Overexpression has an effect on chromosome stability..
Protein Sequence	MLHQKIAHKVRKVVVPGISLLIFFQGCLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFIVLVSSILHVVAPSAVRITTENSSVPKGTFFLDLKKKRILSHLKSNSVAICNHQIYTDWIFLWWLAYTSNLGANVFIILKKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDSNARGAGSLAGKSPERITEEGESIWNPEVIDPKQIHWPYNLILFPEGTNLSADTRQKSAKYAAKIGKKPFKNVLLPHSTGLRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIFLEGKYPKLVDIHIRAFDVKDIPLEDENEFSEWLYKIWSEKDALMERYYSTGSFVSDPETNHSVTDSFKINRIELTEVLILPTLTIIWLVYKLYCFIF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
187	Phosphorylation	SNARGAGSLAGKSPE CCCCCCCCCCCCCHH	17.95	25704821
202	Phosphorylation	RITEEGESIWNPEVI HCCCCCCCCCCHHCC	43.70	27017623
212	Ubiquitination	NPEVIDPKQIHWPYN CHHCCCHHHCCCCCE	59.13	17644757

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CST26_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CST26_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CST26_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UIP3_YEAST	UIP3	physical	18719252
MTU1_YEAST	SLM3	genetic	20093466
BCS1_YEAST	BCS1	genetic	20093466
RLA4_YEAST	RPP2B	genetic	20093466
PCP1_YEAST	PCP1	genetic	20093466
SAC1_YEAST	SAC1	genetic	20093466
SWI6_YEAST	SWI6	genetic	20093466
UPS1_YEAST	UPS1	genetic	20093466
PET8_YEAST	PET8	genetic	20093466
COQ7_YEAST	CAT5	genetic	20093466
YAR1_YEAST	YAR1	genetic	20093466
QCR2_YEAST	QCR2	genetic	20093466
HSP72_YEAST	SSA2	physical	22940862
DED1_YEAST	DED1	physical	22940862
HSP71_YEAST	SSA1	physical	22940862
SSB1_YEAST	SSB1	physical	22940862
MON1_YEAST	MON1	genetic	23891562
YPT7_YEAST	YPT7	genetic	23891562
VAM6_YEAST	VAM6	genetic	23891562
VAM7_YEAST	VAM7	genetic	23891562
VAM3_YEAST	VAM3	genetic	23891562
GET2_YEAST	GET2	genetic	23891562
RGP1_YEAST	RGP1	genetic	23891562
RIC1_YEAST	RIC1	genetic	23891562
ELO3_YEAST	ELO3	genetic	23891562
SWI6_YEAST	SWI6	genetic	27708008
UPS1_YEAST	UPS1	genetic	27708008
MTU1_YEAST	SLM3	genetic	27708008
RRP8_YEAST	RRP8	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
COX12_YEAST	COX12	genetic	27708008
COQ7_YEAST	CAT5	genetic	27708008
GGPPS_YEAST	BTS1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CST26_YEAST

Related Literatures of Post-Translational Modification