UniProt ID | CST26_YEAST | |
---|---|---|
UniProt AC | P38226 | |
Protein Name | Uncharacterized acyltransferase CST26 | |
Gene Name | CST26 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 397 | |
Subcellular Localization |
Lipid droplet . Membrane Multi-pass membrane protein . |
|
Protein Description | Overexpression has an effect on chromosome stability.. | |
Protein Sequence | MLHQKIAHKVRKVVVPGISLLIFFQGCLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFIVLVSSILHVVAPSAVRITTENSSVPKGTFFLDLKKKRILSHLKSNSVAICNHQIYTDWIFLWWLAYTSNLGANVFIILKKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDSNARGAGSLAGKSPERITEEGESIWNPEVIDPKQIHWPYNLILFPEGTNLSADTRQKSAKYAAKIGKKPFKNVLLPHSTGLRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIFLEGKYPKLVDIHIRAFDVKDIPLEDENEFSEWLYKIWSEKDALMERYYSTGSFVSDPETNHSVTDSFKINRIELTEVLILPTLTIIWLVYKLYCFIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
187 | Phosphorylation | SNARGAGSLAGKSPE CCCCCCCCCCCCCHH | 17.95 | 25704821 | |
202 | Phosphorylation | RITEEGESIWNPEVI HCCCCCCCCCCHHCC | 43.70 | 27017623 | |
212 | Ubiquitination | NPEVIDPKQIHWPYN CHHCCCHHHCCCCCE | 59.13 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CST26_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CST26_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CST26_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...