dbPTM

PCP1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PCP1_YEAST
UniProt AC	P53259
Protein Name	Rhomboid protein 1, mitochondrial
Gene Name	PCP1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	346
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Mitochondrial rhomboid serine protease processing the mitochondrial membrane fusion regulator MGM1, and the cytochrome c peroxidase (CCP1). Required for TIM11 stability, ATP synthase complex assembly, mitochondrial morphology, cytochrome c (CYC1) storage and mitochondrial genome maintenance..
Protein Sequence	MSGVSSVMLGLRPATRIFFRSNISVSPSRTFVSYIGRSQSTSILKNAPNLEDNVTNLQKIIPKRFFSQTSILKSRWKPIFNEETTNRYVRLNRFQQYQQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	ATRIFFRSNISVSPS CCEEEECCCCEECCC	33.10	28889911
24	Phosphorylation	IFFRSNISVSPSRTF EEECCCCEECCCCEE	22.31	28889911
26	Phosphorylation	FRSNISVSPSRTFVS ECCCCEECCCCEEEE	15.46	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PCP1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PCP1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PCP1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCPR_YEAST	CCP1	physical	12774122
MGM1_YEAST	MGM1	physical	12774122
MGM1_YEAST	MGM1	genetic	12707284
DNM1_YEAST	DNM1	genetic	12901865
SHE9_YEAST	SHE9	genetic	27708008
FIS1_YEAST	FIS1	genetic	27708008
MDV1_YEAST	MDV1	genetic	27708008
DNM1_YEAST	DNM1	genetic	27708008
MDM30_YEAST	MDM30	genetic	27708008
MDM38_YEAST	MDM38	genetic	27708008
ULS1_YEAST	ULS1	genetic	27708008
CALM_YEAST	CMD1	genetic	27708008
GLE1_YEAST	GLE1	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
MET30_YEAST	MET30	genetic	27708008
TIM16_YEAST	PAM16	genetic	27708008
TIM14_YEAST	PAM18	genetic	27708008
HRP1_YEAST	HRP1	genetic	27708008
TYSY_YEAST	CDC21	genetic	27708008
PROF_YEAST	PFY1	genetic	27708008
MYO2_YEAST	MYO2	genetic	27708008
GEM1_YEAST	GEM1	genetic	27708008
HPC2_YEAST	HPC2	genetic	27708008
RMD9L_YEAST	YBR238C	genetic	27708008
IMG2_YEAST	IMG2	genetic	27708008
PP2C1_YEAST	PTC1	genetic	27708008
QRI7_YEAST	QRI7	genetic	27708008
RPA14_YEAST	RPA14	genetic	27708008
NBP2_YEAST	NBP2	genetic	27708008
YER4_YEAST	YER084W	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
TAN1_YEAST	TAN1	genetic	27708008
ADY4_YEAST	ADY4	genetic	27708008
BUD6_YEAST	BUD6	genetic	27708008
TPM1_YEAST	TPM1	genetic	27708008
SWS2_YEAST	SWS2	genetic	27708008
LSM7_YEAST	LSM7	genetic	27708008
HMI1_YEAST	HMI1	genetic	27708008
GET4_YEAST	GET4	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PCP1_YEAST

Related Literatures of Post-Translational Modification