| UniProt ID | TIM16_YEAST | |
|---|---|---|
| UniProt AC | P42949 | |
| Protein Name | Mitochondrial import inner membrane translocase subunit TIM16 | |
| Gene Name | PAM16 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 149 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . |
|
| Protein Description | Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation.. | |
| Protein Sequence | MAHRAFIQVIITGTQVFGKAFAEAYRQAASQSVKQGATNASRRGTGKGEYGGITLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNAKAKAGDASTAKPPPNSTNSSGADNSASSNQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Acetylation | KGDLNMDKINNRFNY CCCCCHHHHHHCEEE | 36.24 | 24489116 | |
| 89 | Acetylation | YLFEVNDKEKGGSFY EEEEECCCCCCCEEE | 57.00 | 24489116 | |
| 109 | Acetylation | YRAAERLKWELAQRE HHHHHHHHHHHHHHH | 44.86 | 24489116 | |
| 138 | Phosphorylation | PPPNSTNSSGADNSA CCCCCCCCCCCCCCC | 30.18 | 20377248 | |
| 139 | Phosphorylation | PPNSTNSSGADNSAS CCCCCCCCCCCCCCC | 39.82 | 20377248 | |
| 146 | Phosphorylation | SGADNSASSNQ---- CCCCCCCCCCC---- | 29.64 | 21440633 | |
| 147 | Phosphorylation | GADNSASSNQ----- CCCCCCCCCC----- | 38.68 | 20377248 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM16_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM16_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM16_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
