| UniProt ID | MET30_YEAST | |
|---|---|---|
| UniProt AC | P39014 | |
| Protein Name | F-box protein MET30 | |
| Gene Name | MET30 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 640 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Negatively regulates sulfur amino acids biosynthesis genes expression. Controls cell cycle function (being required for the G1/S transition and M-phase but not the S-phase), sulfur metabolism, and methionine biosynthesis as part of the E3 ubiquitin ligase complex SCF(Met30). Required for the efficient binding of CDC45 and MCM proteins to origins of replication. Involved in the S-adenosylmethionine (AdoMet)-mediated inhibition of the transcription function of MET4. In the context of the E3 ubiquitin ligase complex SCF(Met30), involved in the degradation of MET4 and the cellular response to cadmium. Required for efficient expression of G1 cyclins.. | |
| Protein Sequence | MRRERQRMMSFEDKDKDDLDNSNSNNSSEMTDTAMMPPLKRLLITGSSDDLAQGSSGKKKMTMATRSPSSSPDLATNDSGTRVQPLPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARIQQNSTGSSSNADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATDNTSDGSSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSECFSGDEFGCVKMYKFDLND | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Phosphorylation | NSNSNNSSEMTDTAM CCCCCCCHHHCCCCC | 33.25 | 27017623 | |
| 31 | Phosphorylation | SNNSSEMTDTAMMPP CCCCHHHCCCCCCCC | 26.58 | 27017623 | |
| 33 | Phosphorylation | NSSEMTDTAMMPPLK CCHHHCCCCCCCCCC | 13.79 | 27017623 | |
| 45 | Phosphorylation | PLKRLLITGSSDDLA CCCEEECCCCCCHHH | 30.86 | 22369663 | |
| 47 | Phosphorylation | KRLLITGSSDDLAQG CEEECCCCCCHHHCC | 23.19 | 22369663 | |
| 48 | Phosphorylation | RLLITGSSDDLAQGS EEECCCCCCHHHCCC | 36.17 | 22369663 | |
| 55 | Phosphorylation | SDDLAQGSSGKKKMT CCHHHCCCCCCCEEE | 24.68 | 19823750 | |
| 56 | Phosphorylation | DDLAQGSSGKKKMTM CHHHCCCCCCCEEEE | 62.55 | 19823750 | |
| 62 | Phosphorylation | SSGKKKMTMATRSPS CCCCCEEEEEECCCC | 16.72 | 21551504 | |
| 65 | Phosphorylation | KKKMTMATRSPSSSP CCEEEEEECCCCCCC | 22.36 | 20377248 | |
| 67 | Phosphorylation | KMTMATRSPSSSPDL EEEEEECCCCCCCCC | 25.44 | 25533186 | |
| 69 | Phosphorylation | TMATRSPSSSPDLAT EEEECCCCCCCCCCC | 44.70 | 21440633 | |
| 70 | Phosphorylation | MATRSPSSSPDLATN EEECCCCCCCCCCCC | 49.64 | 21440633 | |
| 71 | Phosphorylation | ATRSPSSSPDLATND EECCCCCCCCCCCCC | 27.11 | 25752575 | |
| 76 | Phosphorylation | SSSPDLATNDSGTRV CCCCCCCCCCCCCCC | 47.02 | 24961812 | |
| 79 | Phosphorylation | PDLATNDSGTRVQPL CCCCCCCCCCCCCCC | 44.10 | 27017623 | |
| 105 | Phosphorylation | HNPDIQFSPTHTACY CCCCCCCCCCCCHHH | 16.71 | 17330950 | |
| 107 | Phosphorylation | PDIQFSPTHTACYKQ CCCCCCCCCCHHHHH | 30.57 | 19779198 | |
| 109 | Phosphorylation | IQFSPTHTACYKQDL CCCCCCCCHHHHHHH | 22.39 | 27214570 | |
| 143 | Acetylation | DIHHIISKYSNSNDK CHHHHHHHCCCCCHH | 42.14 | 24489116 | |
| 235 | Ubiquitination | CEQHIDRKCPNCGWG HHHHCCCCCCCCCCC | 50.74 | 22106047 | |
| 249 | Ubiquitination | GLPLLHMKRARIQQN CHHHHHHHHHHHHCC | 31.96 | 22106047 | |
| 275 | Ubiquitination | TQTTRPWKVIYRERF CCCCCCEEEEEEECE | 22.80 | 17644757 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET30_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET30_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-47; SER-48; SER-69 ANDSER-105, AND MASS SPECTROMETRY. | |
