UniProt ID | MET32_YEAST | |
---|---|---|
UniProt AC | Q12041 | |
Protein Name | Transcriptional regulator MET32 | |
Gene Name | MET32 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 191 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Auxiliary transcriptional regulator of sulfur amino acid metabolism. Involved in the transcriptional activation of MET28.. | |
Protein Sequence | MEDQDAAFIKQATEAIVDVSLNIDNIDPIIKELLERVRNRQNRLQNKKPALIPAENGVDINSQGGNIKVKKENALPKPPKSSKSKPQDRRNSTGEKRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHYDTLTCRRNRTKLLTAGGEGINELLKKVKQSNIVHRQDNNHNGSSNG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MET32_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET32_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET32_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET32_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LOT6_YEAST | LOT6 | genetic | 20093466 | |
TOM70_YEAST | TOM70 | genetic | 20093466 | |
MAS5_YEAST | YDJ1 | genetic | 20093466 | |
HSP7F_YEAST | SSE1 | genetic | 20093466 | |
MET31_YEAST | MET31 | genetic | 20093466 | |
ATR_YEAST | MEC1 | genetic | 15689486 | |
URE2_YEAST | URE2 | genetic | 20959818 | |
RXT2_YEAST | RXT2 | genetic | 20959818 | |
MET31_YEAST | MET31 | genetic | 20959818 | |
CTK1_YEAST | CTK1 | genetic | 20959818 | |
MET4_YEAST | MET4 | physical | 21172660 | |
REI1_YEAST | REI1 | genetic | 21127252 | |
KCS1_YEAST | KCS1 | genetic | 21127252 | |
MBP1_YEAST | MBP1 | genetic | 21127252 | |
RTG3_YEAST | RTG3 | genetic | 21127252 | |
RCY1_YEAST | RCY1 | genetic | 27708008 | |
IMG2_YEAST | IMG2 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
AP1_YEAST | YAP1 | genetic | 27708008 | |
MAS5_YEAST | YDJ1 | genetic | 27708008 | |
MET31_YEAST | MET31 | genetic | 27708008 | |
HSP7F_YEAST | SSE1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...