| UniProt ID | MET32_YEAST | |
|---|---|---|
| UniProt AC | Q12041 | |
| Protein Name | Transcriptional regulator MET32 | |
| Gene Name | MET32 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 191 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Auxiliary transcriptional regulator of sulfur amino acid metabolism. Involved in the transcriptional activation of MET28.. | |
| Protein Sequence | MEDQDAAFIKQATEAIVDVSLNIDNIDPIIKELLERVRNRQNRLQNKKPALIPAENGVDINSQGGNIKVKKENALPKPPKSSKSKPQDRRNSTGEKRFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHYDTLTCRRNRTKLLTAGGEGINELLKKVKQSNIVHRQDNNHNGSSNG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of MET32_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET32_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET32_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET32_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LOT6_YEAST | LOT6 | genetic | 20093466 | |
| TOM70_YEAST | TOM70 | genetic | 20093466 | |
| MAS5_YEAST | YDJ1 | genetic | 20093466 | |
| HSP7F_YEAST | SSE1 | genetic | 20093466 | |
| MET31_YEAST | MET31 | genetic | 20093466 | |
| ATR_YEAST | MEC1 | genetic | 15689486 | |
| URE2_YEAST | URE2 | genetic | 20959818 | |
| RXT2_YEAST | RXT2 | genetic | 20959818 | |
| MET31_YEAST | MET31 | genetic | 20959818 | |
| CTK1_YEAST | CTK1 | genetic | 20959818 | |
| MET4_YEAST | MET4 | physical | 21172660 | |
| REI1_YEAST | REI1 | genetic | 21127252 | |
| KCS1_YEAST | KCS1 | genetic | 21127252 | |
| MBP1_YEAST | MBP1 | genetic | 21127252 | |
| RTG3_YEAST | RTG3 | genetic | 21127252 | |
| RCY1_YEAST | RCY1 | genetic | 27708008 | |
| IMG2_YEAST | IMG2 | genetic | 27708008 | |
| MRM2_YEAST | MRM2 | genetic | 27708008 | |
| AP1_YEAST | YAP1 | genetic | 27708008 | |
| MAS5_YEAST | YDJ1 | genetic | 27708008 | |
| MET31_YEAST | MET31 | genetic | 27708008 | |
| HSP7F_YEAST | SSE1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
