dbPTM

RUB1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RUB1_YEAST
UniProt AC	Q03919
Protein Name	NEDD8-like protein RUB1
Gene Name	RUB1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	77
Subcellular Localization
Protein Description	Ubiquitin-like protein modifier that can be covalently attached to lysine residues of target proteins. Activated by the dimeric UBA3-ULA1 E1 enzyme and conjugated by the E2 UBC12 to substrate proteins. RUB1-conjugated (neddylated) substrate proteins include the cullins CDC53, RTT101 and CUL3, and the modification enhances the ubiquitin-ligase activity of the corresponding cullin-RING-based E3 ubiquitin-protein ligase complexes (CRLs)..
Protein Sequence	MIVKVKTLTGKEISVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLVLTLRGGN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Ubiquitination	--MIVKVKTLTGKEI --CEEEEEECCCCEE	31.90	23749301
11	Ubiquitination	KVKTLTGKEISVELK EEEECCCCEEEEEEE	46.79	23749301
48	Acetylation	QRLIFQGKQIDDKLT HEEEECCCCCCCCEE	33.04	24489116
48	Ubiquitination	QRLIFQGKQIDDKLT HEEEECCCCCCCCEE	33.04	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RUB1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RUB1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RUB1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PMT5_YEAST	PMT5	physical	16554755
HCH1_YEAST	HCH1	physical	16554755
CRC1_YEAST	CRC1	physical	16554755
RUD3_YEAST	RUD3	physical	16554755
SEC66_YEAST	SEC66	genetic	17314980
POP8_YEAST	POP8	genetic	19061648
RPN10_YEAST	RPN10	genetic	19061648
PAP2_YEAST	PAP2	genetic	19061648
CSI1_YEAST	CSI1	genetic	19061648
LAG2_YEAST	LAG2	genetic	19763088
LAG2_YEAST	LAG2	genetic	19942853
RPN10_YEAST	RPN10	genetic	20093466
YJQ3_YEAST	YJL163C	genetic	20093466
ATP10_YEAST	ATP10	genetic	20093466
GTR1_YEAST	GTR1	genetic	20093466
RTG3_YEAST	RTG3	genetic	21127252
KCS1_YEAST	KCS1	genetic	21127252
PP2C1_YEAST	PTC1	genetic	21127252
UBC4_YEAST	UBC4	genetic	21816351
TFB3_YEAST	TFB3	genetic	21816351
RAD17_YEAST	RAD17	genetic	23273983
DDC1_YEAST	DDC1	genetic	23273983
RAD24_YEAST	RAD24	genetic	23273983
RD23A_HUMAN	RAD23A	physical	23105008
UBQL1_HUMAN	UBQLN1	physical	23105008
DDI1_YEAST	DDI1	physical	23105008
RPN10_YEAST	RPN10	physical	23105008
DSK2_YEAST	DSK2	physical	23105008
RPN10_YEAST	RPN10	genetic	27708008
YJQ3_YEAST	YJL163C	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
GTR1_YEAST	GTR1	genetic	27708008
SIN3_YEAST	SIN3	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RUB1_YEAST

Related Literatures of Post-Translational Modification