dbPTM

CSI1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CSI1_YEAST
UniProt AC	Q04368
Protein Name	Cop9 signalosome-interactor 1
Gene Name	CSI1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	295
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes The CSN complex is involved in the regulation of the mating pheromone response..
Protein Sequence	MDLLKFSSLAISEINFLHESSFDSIDHSWFLLIGCKLDQDDEIYIPINGNEAESQWYIEKVIRIPMQENDKINQERLERRINLTKVTQKDICILGILDLCQLEEDENITNKVTEKVLTQLTALALKYLIKYNVFRQHTSFQEAVNSLKGYKIENSVQIGAEIILDFLQDKVQIKDVNDRYQIPTPNNTVDPGFDEFQLIDMKDKEINIQKYNNNTIRKLLEKINRMIIFLKNYDATDKPFSSTQDVILRKISMLVTQLQRGGTSDMNYLLDNKINEIKLLEISCKQWEISNMLKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CSI1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CSI1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CSI1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CSI1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
POP2_YEAST	POP2	physical	10688190
CSN12_YEAST	YJR084W	physical	12672462
CSN12_YEAST	YJR084W	physical	12446563
CSN9_YEAST	CSN9	physical	12446563
COG2_YEAST	COG2	physical	11283351
TCM62_YEAST	TCM62	genetic	20093466
BMT2_YEAST	BMT2	genetic	20093466
UBC13_YEAST	UBC13	genetic	20093466
WDR59_YEAST	MTC5	genetic	20093466
YEY6_YEAST	YER156C	genetic	20093466
SRR1L_YEAST	BER1	genetic	20093466
UME6_YEAST	UME6	genetic	27708008
IMG2_YEAST	IMG2	genetic	27708008
WDR59_YEAST	MTC5	genetic	27708008
MSN5_YEAST	MSN5	genetic	27708008
YEY6_YEAST	YER156C	genetic	27708008
THIK_YEAST	POT1	genetic	27708008
VPH1_YEAST	VPH1	genetic	27708008
FUMH_YEAST	FUM1	genetic	27708008
TTL_YEAST	PBY1	genetic	29674565
MMS4_YEAST	MMS4	genetic	29674565
NSE4_YEAST	NSE4	genetic	29674565
NMD2_YEAST	NMD2	genetic	29674565
SLX4_YEAST	SLX4	genetic	29674565
SGS1_YEAST	SGS1	genetic	29674565
SNF11_YEAST	SNF11	genetic	29674565
CSF1_YEAST	CSF1	genetic	29674565
NOP12_YEAST	NOP12	genetic	29674565
BUB3_YEAST	BUB3	genetic	29674565
PUS1_YEAST	PUS1	genetic	29674565
TFC3_YEAST	TFC3	genetic	29674565
H3_YEAST	HHT1	genetic	29674565
SLX5_YEAST	SLX5	genetic	29674565
STN1_YEAST	STN1	genetic	29674565
CCH1_YEAST	CCH1	genetic	29674565
HIR3_YEAST	HIR3	genetic	29674565
FRA1_YEAST	FRA1	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CSI1_YEAST

Related Literatures of Post-Translational Modification