| UniProt ID | SRR1L_YEAST | |
|---|---|---|
| UniProt AC | Q06688 | |
| Protein Name | SRR1-like protein BER1 | |
| Gene Name | BER1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 274 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . | |
| Protein Description | Involved in microtubule stability and kinetochore function. May be involved in protein N-terminus acetylation and/or proteasome biogenesis.. | |
| Protein Sequence | MDFKASGTKFKKTGKKVVPAKAFEEIVQTNRDVLKKSAFLSDLLENLQPHLNNIKKIRCVAIGNFKEDFPATYQFALLLEITDYIKSEDERDVVVSLYDPIFTKEEIQYLKSLGSKWLIEEEFSENDAIDYESVLYFLPHAPLDLTENILSSQRPHLWLANNMISHTDRYTKAKLCENYPNLSKLVHYLQTNAPPEVKKAHDVDGFATFIPKRKRKNRNNSSKLKVTPSDIDYDSIAPKFKSCQILTDFDEGKYLKEKPWINSFSDLTLHAIEY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 225 | Ubiquitination | RNNSSKLKVTPSDID CCCCCCCCCCHHHCC | 48.04 | 23749301 | |
| 227 | Phosphorylation | NSSKLKVTPSDIDYD CCCCCCCCHHHCCHH | 18.58 | 23749301 | |
| 229 | Phosphorylation | SKLKVTPSDIDYDSI CCCCCCHHHCCHHHH | 37.52 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRR1L_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRR1L_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRR1L_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SNF5_YEAST | SNF5 | genetic | 27708008 | |
| BRE5_YEAST | BRE5 | genetic | 27708008 | |
| MET22_YEAST | MET22 | genetic | 27708008 | |
| GGPPS_YEAST | BTS1 | genetic | 27708008 | |
| UBC4_YEAST | UBC4 | genetic | 27708008 | |
| MCFS2_YEAST | EHT1 | genetic | 27708008 | |
| BUD31_YEAST | BUD31 | genetic | 27708008 | |
| RLA3_YEAST | RPP1B | genetic | 27708008 | |
| LSM6_YEAST | LSM6 | genetic | 27708008 | |
| RL9A_YEAST | RPL9A | genetic | 27708008 | |
| SHU1_YEAST | SHU1 | genetic | 27708008 | |
| SNF6_YEAST | SNF6 | genetic | 27708008 | |
| SDS3_YEAST | SDS3 | genetic | 27708008 | |
| DAL81_YEAST | DAL81 | genetic | 27708008 | |
| PTK2_YEAST | PTK2 | genetic | 27708008 | |
| CWP2_YEAST | CWP2 | genetic | 27708008 | |
| SRC1_YEAST | SRC1 | genetic | 27708008 | |
| VPS9_YEAST | VPS9 | genetic | 27708008 | |
| GBLP_YEAST | ASC1 | genetic | 27708008 | |
| MKS1_YEAST | MKS1 | genetic | 27708008 | |
| SIN3_YEAST | SIN3 | genetic | 27708008 | |
| IRA2_YEAST | IRA2 | genetic | 27708008 | |
| RS10A_YEAST | RPS10A | genetic | 27708008 | |
| MSC6_YEAST | MSC6 | genetic | 27708008 | |
| VPS4_YEAST | VPS4 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...