| UniProt ID | BMT2_YEAST | |
|---|---|---|
| UniProt AC | P38278 | |
| Protein Name | 25S rRNA (adenine(2142)-N(1))-methyltransferase {ECO:0000255|HAMAP-Rule:MF_03044} | |
| Gene Name | BMT2 {ECO:0000255|HAMAP-Rule:MF_03044} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 337 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | S-adenosyl-L-methionine-dependent methyltransferase that specifically methylates the N(1) position of adenine 2142 in 25S rRNA. N(1)-methyladenine(2142) in 25S rRNA is present in helix 65, a region that accounts for most of the intersubunit surface of the large subunit.. | |
| Protein Sequence | MHSRKSKSITGKRKQVGSNVTRVIKPQKTRRIIRRFHHLINKRQSICKFLCLKENLDDSNEEKNDKIIRLSIKGNVRLGKYYEDGKSQSFNDAMESQLLRLHSLIKNESKSKDTSDLAVMYTLLGYIMNQINKLGGLETYQIASQNGQLKERGGDTSKLLEKWIRSSFENCPGAVALEIGSLSSGNRISRCALFRNVVRIDLEEHEGVIKQDFMERPLPRNENDKFDLISCSLVLNFVKNHRDRGAMCHRMVKFLKPQGYIFIVLPQACVTHSRYCDKTLLQNLLGSIGLIMLNSHQSNKLYYCLYQLQVVPPQPSSFSKRIKVNDGPGLNNFGITL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 260 | Phosphorylation | KFLKPQGYIFIVLPQ HHHCCCCEEEEEEEC | 28889911 | ||
| 271 | Phosphorylation | VLPQACVTHSRYCDK EEECHHHHCHHHCCH | 28889911 | ||
| 273 | Phosphorylation | PQACVTHSRYCDKTL ECHHHHCHHHCCHHH | 28889911 | ||
| 275 | Phosphorylation | ACVTHSRYCDKTLLQ HHHHCHHHCCHHHHH | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BMT2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BMT2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BMT2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
