UniProt ID | FIS1_YEAST | |
---|---|---|
UniProt AC | P40515 | |
Protein Name | Mitochondrial fission 1 protein | |
Gene Name | FIS1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 155 | |
Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein . |
|
Protein Description | Has a role in mitochondrial fission. Has a role in outer membrane fission but not matrix separation. Required for targeting MDV1 to the mitochondria. Regulates the assembly of DNM1 into punctate structures, in the mitochondrial tubules, promoting mitochondrial membrane constriction and/or division.. | |
Protein Sequence | MTKVDFWPTLKDAYEPLYPQQLEILRQQVVSEGGPTATIQSRFNYAWGLIKSTDVNDERLGVKILTDIYKEAESRRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVEDKIQKETLKGVVVAGGVLAGAVAVASFFLRNKRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Ubiquitination | -----MTKVDFWPTL -----CCCCCCCCCH | 38.21 | 24961812 | |
66 | Phosphorylation | RLGVKILTDIYKEAE HHHHHHHHHHHHHHH | 24.67 | 28889911 | |
69 | Phosphorylation | VKILTDIYKEAESRR HHHHHHHHHHHHHHH | 12.94 | 28889911 | |
70 | Acetylation | KILTDIYKEAESRRR HHHHHHHHHHHHHHH | 51.27 | 24489116 | |
74 | Phosphorylation | DIYKEAESRRRECLY HHHHHHHHHHHHHHH | 37.83 | 28889911 | |
123 | Acetylation | LKSMVEDKIQKETLK HHHHHHHHHHHHHHC | 33.27 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FIS1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FIS1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FIS1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...