| UniProt ID | MBA1_YEAST | |
|---|---|---|
| UniProt AC | P38300 | |
| Protein Name | Inner membrane mitoribosome receptor MBA1, mitochondrial {ECO:0000303|PubMed:25609543} | |
| Gene Name | MBA1 {ECO:0000303|PubMed:8690083} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 278 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . Localizes near the mitoribosome exit tunnel. |
|
| Protein Description | Mitochondrial inner membrane-associated mitoribosome receptor that spatially aligns the mitoribosome exit tunnel with the membrane insertion machinery and allows cotranslational protein membrane insertion.. | |
| Protein Sequence | MSVLRSTCLFFPPRSLLISFNKRRLFSTSRLILNKESETTKKKDKSKQQDFNPRHLGVAAEIFIPSAYKNLPNVFAHPLIVANALIRRLYTFGLNSVQVALFRFQSGIKPSFLLWKNKAIETYINVNTSFAHKNLSDIKGLVSLWVQEALEARSRQLPGNATLDWQLIKFNAVPKLVSVQPIMIPGMPLEHLQLVYKFDTKQRLIKVNQQTKKTETLDRDVVDYIAFLCDATTNDMILMGSLFESKPNDKLPKSYEDDAKVAIHRMKVNGDIYRLPPS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 260 | Acetylation | KSYEDDAKVAIHRMK CCCCCCHHHEEEEEE | 38.91 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MBA1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MBA1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MBA1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| OXA1_YEAST | OXA1 | genetic | 16601683 | |
| RM04_YEAST | MRPL4 | physical | 20404317 | |
| RM22_YEAST | MRPL22 | physical | 20404317 | |
| MDM38_YEAST | MDM38 | genetic | 20427570 | |
| HSP71_YEAST | SSA1 | physical | 22940862 | |
| SSB1_YEAST | SSB1 | physical | 22940862 | |
| OXA1_YEAST | OXA1 | genetic | 23198851 | |
| SNT1_YEAST | SNT1 | genetic | 27708008 | |
| ARX1_YEAST | ARX1 | genetic | 27708008 | |
| UME6_YEAST | UME6 | genetic | 27708008 | |
| RLA4_YEAST | RPP2B | genetic | 27708008 | |
| CYM1_YEAST | CYM1 | genetic | 27708008 | |
| AIM11_YEAST | AIM11 | genetic | 27708008 | |
| ARO8_YEAST | ARO8 | genetic | 27708008 | |
| UPS1_YEAST | UPS1 | genetic | 27708008 | |
| PFKA2_YEAST | PFK2 | genetic | 27708008 | |
| YN8O_YEAST | YNR040W | genetic | 27708008 | |
| RS10A_YEAST | RPS10A | genetic | 27708008 | |
| NEW1_YEAST | NEW1 | genetic | 27708008 | |
| COX20_YEAST | COX20 | physical | 27550809 | |
| MSS2_YEAST | MSS2 | physical | 27550809 | |
| PNT1_YEAST | PNT1 | physical | 27550809 | |
| COX2_YEAST | COX2 | physical | 27550809 | |
| RM04_YEAST | MRPL4 | physical | 27550809 | |
| RT51_YEAST | MRP51 | physical | 27550809 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
