UniProt ID | PNT1_YEAST | |
---|---|---|
UniProt AC | P38969 | |
Protein Name | Pentamidine resistance factor, mitochondrial | |
Gene Name | PNT1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 423 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Probably involved in mitochondrial export. Confers resistance to the anti-pneumocystis carinii drug pentamidine. May act by the removal of pentamidine, or its damage targets, from the matrix by an active-transport mechanism.. | |
Protein Sequence | MDSRVALVRKYIAPSVIKSDSIQLHGLVKAPLFKALNSRYKLGSLQIVQDVDWNAKTTPSDSPEPLAATLNSNRSLPMTKFPKQEILEQVKLDTKVGKWRKFMTGWFRIGLYLLKSYKTGIQNTLKVFWDTRNEEQKFSIKNGALANLVREIEMHEINTRLSSSSLPTSSSAKAPLRPLSINRKTLVELIRRDQIWKLPVFFTLVFIFEEVSVLIFTFFPRVCPYNCLTPGGYKKLSNSYIKGTTSTQGNYGLGPLEFTKQGTIKYEPPYAVPIENLYNFLTSFPQSMISNWKLYIYKKLKLQKLLCNEIEKIYQYLFIDDWLLLQSILNTDVEKTKIALSDRELVNCILERKLYHMGDDLNEMVNDTLGKEILLKRLFLYWTLRYNDTISLNGKHTFSEKWGVNNISLLKYNSELVATKDIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | RVALVRKYIAPSVIK HHHHHHHHHCCHHCC | 7.55 | 28889911 | |
15 | Phosphorylation | VRKYIAPSVIKSDSI HHHHHCCHHCCCCCE | 27.70 | 28889911 | |
246 | Phosphorylation | SYIKGTTSTQGNYGL CEECCCCCCCCCCCC | 20.69 | 28889911 | |
251 | Phosphorylation | TTSTQGNYGLGPLEF CCCCCCCCCCCCEEE | 22.13 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNT1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNT1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNT1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...