| UniProt ID | CISY3_YEAST | |
|---|---|---|
| UniProt AC | P43635 | |
| Protein Name | Citrate synthase 3, mitochondrial {ECO:0000303|PubMed:9140965} | |
| Gene Name | CIT3 {ECO:0000303|PubMed:9140965} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 486 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Dual specificity mitochondrial citrate and methylcitrate synthase with similar catalytic efficiency with both acetyl-CoA and propionyl-CoA.. | |
| Protein Sequence | MVQRLLPGAHICRRSFNSSAIIKSSALTLKEALENVIPKKRDAVKKLKACYGSTFVGPITISSVLGGMRGNQSMFWQGTSLDPEHGIKFQGLTIEECQNRLPNTGIDGDNFLPESMLWLLMTGGVPTFQQAASFRKELAIRGRKLPHYTEKVLSSLPKDMHPMTQLAIGLASMNKGSLFATNYQKGLIGKMEFWKDTLEDSLNLIASLPLLTGRIYSNITNEGHPLGQYSEEVDWCTNICSLLGMTNGTNSSNTCNLTSQQSLDFINLMRLYTGIHVDHEGGNVSAHTTHLVGSALSDPYLSYSSGIMGLAGPLHGLAAQEVVRFLIEMNSNISSIAREQEIKDYLWKILNSNRVIPGYGHAVLRKPDPRFTAMLEFAQKRPIEFENDKNVLLMQKLAEIAPKVLLEHGKSKNPFPNVDSASGILFYHYGIRELLFFTVIFGCSRAMGPLTQLVWDRILGLPIERPKSLNLEGLEALTKASNVNKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 366 | Ubiquitination | YGHAVLRKPDPRFTA CCCHHHCCCCHHHHH | 50.00 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CISY3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CISY3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CISY3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PTH_YEAST | PTH1 | genetic | 20093466 | |
| MDV1_YEAST | MDV1 | genetic | 20093466 | |
| MHP1_YEAST | MHP1 | genetic | 20093466 | |
| RHO4_YEAST | RHO4 | genetic | 20093466 | |
| RL37A_YEAST | RPL37A | genetic | 20093466 | |
| SMA2_YEAST | SMA2 | genetic | 20093466 | |
| COG6_YEAST | COG6 | genetic | 20093466 | |
| OSH2_YEAST | OSH2 | genetic | 21987634 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| DCP2_YEAST | DCP2 | genetic | 27708008 | |
| TPT1_YEAST | TPT1 | genetic | 27708008 | |
| CANB_YEAST | CNB1 | genetic | 27708008 | |
| PET8_YEAST | PET8 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
