UniProt ID | TPT1_YEAST | |
---|---|---|
UniProt AC | Q12272 | |
Protein Name | tRNA 2'-phosphotransferase | |
Gene Name | TPT1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 230 | |
Subcellular Localization | ||
Protein Description | Catalyzes the last step of tRNA splicing, the transfer of the splice junction 2'-phosphate from ligated tRNA to NAD to produce ADP-ribose 1''-2'' cyclic phosphate.. | |
Protein Sequence | MRQVLQKDKRDVQLSKALSYLLRHTAVKEKLTIDSNGYTPLKELLSHNRLKTHKCTVDDIHRIVKENDKQRFHIKTLGADEEWICATQGHSIKSIQPSDEVLVPITEASQLPQELIHGTNLQSVIKIIESGAISPMSRNHVHLSPGMLHAKGVISGMRSSSNVYIFIDCHSPLFFQTLKMFRSLNNVYLSSSIPVELIQKVVVKGNLKDEEKLDTLRRILHERNIPLEKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Acetylation | -MRQVLQKDKRDVQL -CCHHHHHHHHHHHH | 62.14 | 25381059 | |
19 | Phosphorylation | VQLSKALSYLLRHTA HHHHHHHHHHHHHHH | 20.70 | 21440633 | |
130 | Phosphorylation | SVIKIIESGAISPMS HHHHHHHCCCCCCCC | 24.10 | 26447709 | |
134 | Phosphorylation | IIESGAISPMSRNHV HHHCCCCCCCCCCCC | 17.64 | 26447709 | |
137 | Phosphorylation | SGAISPMSRNHVHLS CCCCCCCCCCCCCCC | 33.06 | 26447709 | |
151 | Acetylation | SPGMLHAKGVISGMR CCCHHHHHHHEECCC | 42.85 | 25381059 | |
208 | Acetylation | VVVKGNLKDEEKLDT HEECCCCCCHHHHHH | 68.07 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPT1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPT1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPT1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...