| UniProt ID | CSH1_YEAST | |
|---|---|---|
| UniProt AC | P38287 | |
| Protein Name | Mannosyl phosphorylinositol ceramide synthase CSH1 | |
| Gene Name | CSH1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 376 | |
| Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . |
|
| Protein Description | Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide.. | |
| Protein Sequence | MKKELKILIIANIALLISIIHYTFDLLTLCIDDTSKDALTDEQLNPPNGFNSTFYESPPQLIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQPADYKMHNNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLCSGPFNNKRYYIQWLSDKFKLHKWKLTSSYKNKEKRRNPTRHEYNSRGKRLRKDSNIPYDSVFLDIEKNHAKFTDLT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 166 | Ubiquitination | KVPAFLRKTSPTGVS CCCCHHHCCCCCCCC | 56.34 | 23749301 | |
| 330 | Ubiquitination | WKLTSSYKNKEKRRN CCCCHHCCCHHHHCC | 64.59 | 23749301 | |
| 354 | Phosphorylation | GKRLRKDSNIPYDSV CCHHCCCCCCCCCEE | 39.43 | 17330950 | |
| 371 | Ubiquitination | DIEKNHAKFTDLT-- EHHHHCCCCCCCC-- | 41.04 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSH1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSH1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSH1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-354, AND MASSSPECTROMETRY. | |