dbPTM

YO059_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YO059_YEAST
UniProt AC	Q08448
Protein Name	Putative lipase YOR059C
Gene Name	YOR059C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	450
Subcellular Localization	Lipid droplet . Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MTSDKHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNAMFKTFDGIEIIGYRTLIEVCEFIRDYKDGKITKLSVMGYSQGGLVARFMIGKMLTEFKELFEDIEPQLFITMATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIANSSNNILVKLSQGEYLEALSLFKWRIAFANVKNDRTVAFYTAFITDCDPFIDFDNKLKYTFEEKIPGSGYKGILPKIVDLNALNVNSHAPTKPTKTYKKWGRTILIILVATFLILPIALVMNGLGTAYSYIVTCKYRKMLSNGILHNEVRGKLGLTEQLKGYVTDAYGSIINSALDMDANYEASNSNLVNEEELPWKEFIQKYTTINDGVWKSKFKKLPFDENRKVILRNLNKLKWIRVPIYIKAVNAHGVIVARRGMDENTAATGIACIEFTAQLLAYLMHKSN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YO059_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YO059_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YO059_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YO059_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRM8_YEAST	PRM8	physical	11283351
SSB1_YEAST	SSB1	physical	22940862
YO059_YEAST	LPL1	physical	22940862
MTU1_YEAST	SLM3	genetic	27708008
TFS2_YEAST	DST1	genetic	27708008
AIM18_YEAST	AIM18	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
TBP6_YEAST	YTA6	genetic	27708008
SRO7_YEAST	SRO7	genetic	27708008
ATC3_YEAST	DRS2	genetic	27708008
AP2A_YEAST	APL3	genetic	27708008
RIM1_YEAST	RIM1	genetic	27708008
YCY0_YEAST	YCR090C	genetic	27708008
TPS2_YEAST	TPS2	genetic	27708008
DHAS_YEAST	HOM2	genetic	27708008
SND1_YEAST	YDR186C	genetic	27708008
AAKG_YEAST	SNF4	genetic	27708008
MED5_YEAST	NUT1	genetic	27708008
MTO1_YEAST	MTO1	genetic	27708008
CHO2_YEAST	CHO2	genetic	27708008
GOSR1_YEAST	GOS1	genetic	27708008
ICE2_YEAST	ICE2	genetic	27708008
CBF1_YEAST	CBF1	genetic	27708008
YJ66_YEAST	YJR096W	genetic	27708008
DPH4_YEAST	JJJ3	genetic	27708008
CTL1_YEAST	CTL1	genetic	27708008
MKS1_YEAST	MKS1	genetic	27708008
LSM7_YEAST	LSM7	genetic	27708008
MKK1_YEAST	MKK1	genetic	27708008
RFM1_YEAST	RFM1	genetic	27708008
SNU66_YEAST	SNU66	genetic	27708008
VTS1_YEAST	VTS1	genetic	27708008
QCR2_YEAST	QCR2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YO059_YEAST

Related Literatures of Post-Translational Modification