UniProt ID | YJ66_YEAST | |
---|---|---|
UniProt AC | P47137 | |
Protein Name | Uncharacterized oxidoreductase YJR096W | |
Gene Name | YJR096W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 282 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVPKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLRLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLCHGYKMTNPDLLKVCKEVDRNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDHPDAYEPTDWECTDAP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MVPKFYKLSNGFK --CCCCEEECCCCCC | 19.69 | 27017623 | |
151 | Acetylation | GVSNYGKKHIDELLN CCCCCCHHHHHHHHC | 41.24 | 24489116 | |
215 | Acetylation | PDLLKVCKEVDRNPG HHHHHHHHHHCCCCC | 64.85 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJ66_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJ66_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJ66_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RT05_YEAST | MRPS5 | physical | 16554755 | |
RT24_YEAST | RSM24 | physical | 16554755 | |
HSP71_YEAST | SSA1 | physical | 19536198 | |
RS8A_YEAST | RPS8A | genetic | 20093466 | |
RS8B_YEAST | RPS8A | genetic | 20093466 | |
EKI1_YEAST | EKI1 | genetic | 20093466 | |
PMT7_YEAST | PMT7 | genetic | 20093466 | |
FCY2_YEAST | FCY2 | genetic | 20093466 | |
GLRX4_YEAST | GRX4 | genetic | 20093466 | |
ODPA_YEAST | PDA1 | genetic | 20093466 | |
KIP3_YEAST | KIP3 | genetic | 20093466 | |
MALX3_YEAST | IMA1 | genetic | 20093466 | |
RPN10_YEAST | RPN10 | genetic | 20093466 | |
IME2_YEAST | IME2 | genetic | 20093466 | |
TCTP_YEAST | TMA19 | genetic | 20093466 | |
DIA2_YEAST | DIA2 | genetic | 20093466 | |
EKI1_YEAST | EKI1 | genetic | 27708008 | |
HKR1_YEAST | HKR1 | genetic | 27708008 | |
ODPA_YEAST | PDA1 | genetic | 27708008 | |
XRN1_YEAST | XRN1 | genetic | 27708008 | |
DAL81_YEAST | DAL81 | genetic | 27708008 | |
TDA5_YEAST | TDA5 | genetic | 27708008 | |
ERG6_YEAST | ERG6 | genetic | 27708008 | |
DIA2_YEAST | DIA2 | genetic | 27708008 | |
WHI5_YEAST | WHI5 | genetic | 27708008 | |
WDR6_YEAST | RTT10 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...