| UniProt ID | YOR97_YEAST | |
|---|---|---|
| UniProt AC | Q12274 | |
| Protein Name | Uncharacterized protein YOR097C | |
| Gene Name | YOR097C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 175 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MDLKRDWLRWKITIGSGPGSIVLDFPSFLVGCVFTTMMGPILQKLIGKLLVGLITVCKFLVIIGSIVFVIGVASKKYTYDDFKVSIKRSGEPGESHDMRTEPKRTAKTATVPMEKDEGVGSYNYFEIPITKETSTIPYINCDGTSSLRKPPNGPSSVGLSNSNRYENFINMARHK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YOR97_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YOR97_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YOR97_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SYEC_YEAST | GUS1 | physical | 16554755 | |
| SMD3_YEAST | SMD3 | physical | 16554755 | |
| RUXE_YEAST | SME1 | physical | 16554755 | |
| ERG6_YEAST | ERG6 | physical | 11283351 | |
| PRP6_YEAST | PRP6 | genetic | 27708008 | |
| POP7_YEAST | POP7 | genetic | 27708008 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| NOP14_YEAST | NOP14 | genetic | 27708008 | |
| CDC37_YEAST | CDC37 | genetic | 27708008 | |
| ERF3_YEAST | SUP35 | genetic | 27708008 | |
| PCF11_YEAST | PCF11 | genetic | 27708008 | |
| PSB3_YEAST | PUP3 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| GNA1_YEAST | GNA1 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| TAF1_YEAST | TAF1 | genetic | 27708008 | |
| CDC12_YEAST | CDC12 | genetic | 27708008 | |
| PSF2_YEAST | PSF2 | genetic | 27708008 | |
| YJ9I_YEAST | YJR141W | genetic | 27708008 | |
| PRS7_YEAST | RPT1 | genetic | 27708008 | |
| AFG2_YEAST | AFG2 | genetic | 27708008 | |
| NOG2_YEAST | NOG2 | genetic | 27708008 | |
| RPA1_YEAST | RPA190 | genetic | 27708008 | |
| IF6_YEAST | TIF6 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...