UniProt ID | YOR97_YEAST | |
---|---|---|
UniProt AC | Q12274 | |
Protein Name | Uncharacterized protein YOR097C | |
Gene Name | YOR097C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 175 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MDLKRDWLRWKITIGSGPGSIVLDFPSFLVGCVFTTMMGPILQKLIGKLLVGLITVCKFLVIIGSIVFVIGVASKKYTYDDFKVSIKRSGEPGESHDMRTEPKRTAKTATVPMEKDEGVGSYNYFEIPITKETSTIPYINCDGTSSLRKPPNGPSSVGLSNSNRYENFINMARHK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YOR97_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YOR97_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YOR97_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYEC_YEAST | GUS1 | physical | 16554755 | |
SMD3_YEAST | SMD3 | physical | 16554755 | |
RUXE_YEAST | SME1 | physical | 16554755 | |
ERG6_YEAST | ERG6 | physical | 11283351 | |
PRP6_YEAST | PRP6 | genetic | 27708008 | |
POP7_YEAST | POP7 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
NOP14_YEAST | NOP14 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
ERF3_YEAST | SUP35 | genetic | 27708008 | |
PCF11_YEAST | PCF11 | genetic | 27708008 | |
PSB3_YEAST | PUP3 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
TAF1_YEAST | TAF1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
PSF2_YEAST | PSF2 | genetic | 27708008 | |
YJ9I_YEAST | YJR141W | genetic | 27708008 | |
PRS7_YEAST | RPT1 | genetic | 27708008 | |
AFG2_YEAST | AFG2 | genetic | 27708008 | |
NOG2_YEAST | NOG2 | genetic | 27708008 | |
RPA1_YEAST | RPA190 | genetic | 27708008 | |
IF6_YEAST | TIF6 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...