UniProt ID | CSN9_YEAST | |
---|---|---|
UniProt AC | Q03981 | |
Protein Name | COP9 signalosome complex subunit 9 | |
Gene Name | CSN9 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 162 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Component of the COP9 signalosome (CSN) complex that acts as a regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes. The CSN complex is involved in the regulation of the mating pheromone response.. | |
Protein Sequence | MVMREETIKSLEDPYKYHYKEEWLNTKDPDEQQLFEIFAFGNIKDLPENIILTSLMRSKLEKLTLVTLSEIYNELSYELIKEECQIEDDGIIESHLIQLQNIFKAEMDSVSKSMKFSRRFDCRDVYCHEKELTIIKNPRVTKEYLVQNLRSWETKLKQNILE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN9_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...