| UniProt ID | YMK8_YEAST | |
|---|---|---|
| UniProt AC | Q03759 | |
| Protein Name | Uncharacterized protein YML108W | |
| Gene Name | YML108W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 105 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSKSNTYRMLVLLEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSKSNTYRM ------CCCCCEEEE | 44.80 | 22814378 | |
| 21 | Acetylation | EDDTKINKEDEKFLK CCCCCCCHHHHHHHC | 70.75 | 25381059 | |
| 25 | Acetylation | KINKEDEKFLKGKPG CCCHHHHHHHCCCCC | 69.21 | 25381059 | |
| 30 | Acetylation | DEKFLKGKPGKMHEF HHHHHCCCCCCHHHH | 49.35 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YMK8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YMK8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YMK8_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
