| UniProt ID | COQ11_YEAST | |
|---|---|---|
| UniProt AC | Q05892 | |
| Protein Name | MIOREX complex component 2 {ECO:0000305|PubMed:25683707} | |
| Gene Name | COQ11 {ECO:0000303|PubMed:25631044} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 277 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Component of MIOREX complexes, large expressome-like assemblies of ribosomes with factors involved in all the steps of post-transcriptional gene expression. [PubMed: 25683707 Component of a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis] | |
| Protein Sequence | MIPKLIVFGGNGFLGKRICQEAVTSGYQVVSVSRSGKAPHSNELNDKQWMQEVQWTAADIFKPDSYHELLNNATNVVHSLGILLENENYKQTLSKSPTYDSKSRLLSFGAGPNPLKKSSPYFTYEMMNKQSAIILADTFKQKILKKSKKEQEKANQRSFTYISADKGFPLIPSGYINSKREAEIELEKMQRYFRPIIVRPGFMFDEHRNAIGPRSFIHTALELLYCGNKFLLRNKLQLLNDLIRPTVSTQQVSKSVLKNIENPDFKGVVTLEEILKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COQ11_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COQ11_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COQ11_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
