| UniProt ID | SWC5_YEAST | |
|---|---|---|
| UniProt AC | P38326 | |
| Protein Name | SWR1-complex protein 5 | |
| Gene Name | SWC5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 303 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Involved in chromosome stability.. | |
| Protein Sequence | MPEVETKIIPNEKEDEDEDGYIEEEDEDFQPEKDKLGGGSDDSDASDGGDDYDDGVNRDKGRNKVDYSRIESESGGLIKTRRARQAEEEYAKTHKYESLTVESIPAKVNSIWEELQEASKNRLLSSSGKVGSVLDGSKEARSTTAAQQEDKILIERNYKFAGETVHEKKWVSRSSAEGQEYLNSLKFKQQAPAAPVQLEKAVRTKSNESRQHLRRPLKRPPLLEQIISGGLRPKLTTLEKSQLDWASYVDRAGLNDELVLHNKDGFLARQEFLQRVGSAEDERYKELRRQQLAQQLQQDSEAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | KDKLGGGSDDSDASD CCCCCCCCCCCCCCC | 41.33 | 19795423 | |
| 43 | Phosphorylation | LGGGSDDSDASDGGD CCCCCCCCCCCCCCC | 39.81 | 23749301 | |
| 46 | Phosphorylation | GSDDSDASDGGDDYD CCCCCCCCCCCCCCC | 41.60 | 23749301 | |
| 52 | Phosphorylation | ASDGGDDYDDGVNRD CCCCCCCCCCCCCCC | 22.22 | 19795423 | |
| 72 | Phosphorylation | VDYSRIESESGGLIK CCHHHHHCCCCCCCC | 34.39 | 28889911 | |
| 132 | Phosphorylation | SSSGKVGSVLDGSKE CCCCCCCCCCCCCHH | 23.61 | 27017623 | |
| 137 | Phosphorylation | VGSVLDGSKEARSTT CCCCCCCCHHHHCCC | 27.30 | 29734811 | |
| 209 | Phosphorylation | VRTKSNESRQHLRRP HHCCCHHHHHHHHCC | 41.30 | 17287358 | |
| 263 | Acetylation | DELVLHNKDGFLARQ CEEEEECCCCHHHHH | 48.78 | 24489116 | |
| 278 | Phosphorylation | EFLQRVGSAEDERYK HHHHHHCCHHHHHHH | 26.15 | 23749301 | |
| 300 | Phosphorylation | AQQLQQDSEAS---- HHHHHHHHHCC---- | 30.63 | 22369663 | |
| 303 | Phosphorylation | LQQDSEAS------- HHHHHHCC------- | 36.38 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWC5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWC5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWC5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-209, AND MASSSPECTROMETRY. | |
