| UniProt ID | SWC7_YEAST | |
|---|---|---|
| UniProt AC | Q06707 | |
| Protein Name | SWR1-complex protein 7 | |
| Gene Name | SWC7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 132 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling.. | |
| Protein Sequence | MDCPSNVVLLLLQLVLQRQQTLAHRDKSVDLQTLLKDPVIDNDVLVEFKTHKLVQLYGPQYCRDISLRGLKTMVTDIFANGIPKNAQSSGNDQPVTVVDLANYYYMQRINELQNTELPQLKEALLTRLEHMI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 66 | Phosphorylation | PQYCRDISLRGLKTM HHHHHHCCCCCHHHH | 19.12 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWC7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWC7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWC7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
