| UniProt ID | PFD6_YEAST | |
|---|---|---|
| UniProt AC | P52553 | |
| Protein Name | Prefoldin subunit 6 | |
| Gene Name | YKE2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 114 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.. | |
| Protein Sequence | MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSELGAKYQ ------CCHHHHHHH | 41.34 | 22814378 | |
| 46 | Phosphorylation | FDQLEEDTPVYKLTG HHHHCCCCCCEEECC | 20.24 | 24961812 | |
| 49 | Phosphorylation | LEEDTPVYKLTGNVL HCCCCCCEEECCCEE | 11.07 | 24961812 | |
| 50 | Acetylation | EEDTPVYKLTGNVLL CCCCCCEEECCCEEE | 39.54 | 25381059 | |
| 102 | Acetylation | KMRSELIKLNNTAAS HHHHHHHHHHHHHHC | 58.76 | 24489116 | |
| 106 | Phosphorylation | ELIKLNNTAASTGPG HHHHHHHHHHCCCCC | 23.64 | 22369663 | |
| 109 | Phosphorylation | KLNNTAASTGPGR-- HHHHHHHCCCCCC-- | 31.28 | 22369663 | |
| 110 | Phosphorylation | LNNTAASTGPGR--- HHHHHHCCCCCC--- | 42.54 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD6_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
