| UniProt ID | WSS1_YEAST | |
|---|---|---|
| UniProt AC | P38838 | |
| Protein Name | DNA-dependent metalloprotease WSS1 | |
| Gene Name | WSS1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 269 | |
| Subcellular Localization | Nucleus . Present in a single sharp spot near the nuclear membrane, distinct from the spindle pole bodies and nucleolus. In dividing cells, the spot is exclusively present in the mother cell. | |
| Protein Description | Metalloendopeptidase that acts selectively on DNA-binding proteins. DNA is needed to bring the protease and substrates together to enable proteolysis. Involved in the repair of toxic DNA-protein cross-links (DPCs) such as covalently trapped topoisomerase 1 (TOP1) adducts on DNA lesions or DPCs induced by reactive compounds such as formaldehyde. Involved in DNA damage response and processing of stalled or collapsed replication forks by removing the covalently trapped TOP1 from chromatin. DPC proteolysis enables the repair of the lesions via downstream DNA repair pathways. May be recruited to DPCs via the SUMOylation of substrate proteins at damaged DNA sites.. | |
| Protein Sequence | MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKEIAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDEFQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYDTFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGISSIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVILDDDDEVLPGDTLIEVIDLT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MKTEGIKSPSAKYHD CCCCCCCCCCCCCCC | 23.36 | 28889911 | |
| 10 | Phosphorylation | TEGIKSPSAKYHDMA CCCCCCCCCCCCCCC | 44.47 | 28889911 | |
| 19 | Phosphorylation | KYHDMAGSQRIPHKN CCCCCCCCCCCCCCC | 13.52 | 28889911 | |
| 149 | Phosphorylation | VIEQRGLYDTFLGNG HHHCCCCCCCCCCCC | 18.76 | 28889911 | |
| 170 | Phosphorylation | ANLRSNRYPMTGIST CCCCCCCCCCCCEEC | 11.12 | 27017623 | |
| 173 | Phosphorylation | RSNRYPMTGISTNTG CCCCCCCCCEECCCC | 27.19 | 27017623 | |
| 193 | Phosphorylation | GKGVKLGSLHPEGIS CCCCCCCCCCCCCCC | 33.66 | 19779198 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WSS1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WSS1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WSS1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
