| UniProt ID | RAD10_YEAST | |
|---|---|---|
| UniProt AC | P06838 | |
| Protein Name | DNA repair protein RAD10 | |
| Gene Name | RAD10 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 210 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Involved in nucleotide excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Along with RAD1 forms an endonuclease that specifically degrades single-stranded DNA.. | |
| Protein Sequence | MNNTDPTSFESILAGVAKLRKEKSGADTTGSQSLEIDASKLQQQEPQTSRRINSNQVINAFNQQKPEEWTDSKATDDYNRKRPFRSTRPGKTVLVNTTQKENPLLNHLKSTNWRYVSSTGINMIYYDYLVRGRSVLFLTLTYHKLYVDYISRRMQPLSRNENNILIFIVDDNNSEDTLNDITKLCMFNGFTLLLAFNFEQAAKYIEYLNL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MNNTDPTSFES ----CCCCCCCCHHH | 38.05 | 30377154 | |
| 7 | Phosphorylation | -MNNTDPTSFESILA -CCCCCCCCHHHHHH | 49.19 | 30377154 | |
| 8 | Phosphorylation | MNNTDPTSFESILAG CCCCCCCCHHHHHHH | 32.19 | 30377154 | |
| 115 | Phosphorylation | LKSTNWRYVSSTGIN HHHCCCEEECCCCCC | 9.04 | 30377154 | |
| 117 | Phosphorylation | STNWRYVSSTGINMI HCCCEEECCCCCCEE | 17.16 | 30377154 | |
| 118 | Phosphorylation | TNWRYVSSTGINMIY CCCEEECCCCCCEEE | 22.17 | 30377154 | |
| 119 | Phosphorylation | NWRYVSSTGINMIYY CCEEECCCCCCEEEE | 34.28 | 30377154 | |
| 125 | Phosphorylation | STGINMIYYDYLVRG CCCCCEEEEEEHHCC | 4.59 | 30377154 | |
| 126 | Phosphorylation | TGINMIYYDYLVRGR CCCCEEEEEEHHCCC | 6.28 | 30377154 | |
| 128 | Phosphorylation | INMIYYDYLVRGRSV CCEEEEEEHHCCCCC | 7.32 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAD10_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAD10_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAD10_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
