| UniProt ID | ARC1_YEAST | |
|---|---|---|
| UniProt AC | P46672 | |
| Protein Name | tRNA-aminoacylation cofactor ARC1 | |
| Gene Name | ARC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 376 | |
| Subcellular Localization | Cytoplasm . Largely excluded from the nucleus. | |
| Protein Description | Binds to tRNA and functions as a cofactor for the methionyl-tRNA synthetase (MetRS) and glutamyl-tRNA synthetase (GluRS). Forms a complex with MetRS and GluRS and increases their affinity for cognate tRNAs due to the presence of a tRNA binding domain in its middle and C-terminal part. Binds specifically G4 quadruplex nucleic acid structures (these are four-stranded right-handed helices, stabilized by guanine base quartets). Also required for cytoplasmic confinement of the synthetases and tRNA.. | |
| Protein Sequence | MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEINHDLDLPHEVIEKKKKAPAGGAADAAAKADEDVSKKAKKQDHPRGKPDEETLKKLREEAKAKKAAKKAANAKQQQEQQNKAPEKPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNAKGESFKVASIANAQVR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSDLVTKFE ------CCHHHHHHH | 22369663 | ||
| 6 | Phosphorylation | --MSDLVTKFESLII --CCHHHHHHHHHHH | 20377248 | ||
| 10 | Phosphorylation | DLVTKFESLIISKYP HHHHHHHHHHHHCCC | 22369663 | ||
| 14 | Phosphorylation | KFESLIISKYPVSFT HHHHHHHHCCCCCCC | 22369663 | ||
| 15 | Acetylation | FESLIISKYPVSFTK HHHHHHHCCCCCCCH | 24489116 | ||
| 15 | Ubiquitination | FESLIISKYPVSFTK HHHHHHHCCCCCCCH | 24961812 | ||
| 16 | Phosphorylation | ESLIISKYPVSFTKE HHHHHHCCCCCCCHH | 28132839 | ||
| 19 | Phosphorylation | IISKYPVSFTKEQSA HHHCCCCCCCHHHHH | 28889911 | ||
| 22 | Acetylation | KYPVSFTKEQSAQAA CCCCCCCHHHHHHHH | 24489116 | ||
| 36 | Ubiquitination | AQWESVLKSGQIQPH HHHHHHHHHCCCCCC | 17644757 | ||
| 132 | Acetylation | LPHEVIEKKKKAPAG CCHHHHHHHHCCCCC | 22865919 | ||
| 135 | Ubiquitination | EVIEKKKKAPAGGAA HHHHHHHCCCCCCHH | 17644757 | ||
| 147 | Ubiquitination | GAADAAAKADEDVSK CHHHHHHHCCHHHHH | 23749301 | ||
| 147 | Succinylation | GAADAAAKADEDVSK CHHHHHHHCCHHHHH | 23954790 | ||
| 147 | Acetylation | GAADAAAKADEDVSK CHHHHHHHCCHHHHH | 24489116 | ||
| 154 | Ubiquitination | KADEDVSKKAKKQDH HCCHHHHHHHHHCCC | 17644757 | ||
| 155 | Ubiquitination | ADEDVSKKAKKQDHP CCHHHHHHHHHCCCC | 17644757 | ||
| 173 | Acetylation | PDEETLKKLREEAKA CCHHHHHHHHHHHHH | 25381059 | ||
| 203 | Acetylation | QQNKAPEKPKPSAID HHHCCCCCCCCCHHH | 24489116 | ||
| 207 | Phosphorylation | APEKPKPSAIDFRVG CCCCCCCCHHHHHHH | 28889911 | ||
| 218 | Acetylation | FRVGFIQKAIKHPDA HHHHHHHHHHHCCCC | 24489116 | ||
| 221 | Acetylation | GFIQKAIKHPDADSL HHHHHHHHCCCCCCE | 24489116 | ||
| 250 | Acetylation | TVCSGLVKHFPLDAM EEEECCCCCCCHHHC | 24489116 | ||
| 269 | Acetylation | VVVVCNLKPVNMRGI EEEEEECCCCCCCCC | 24489116 | ||
| 269 | Ubiquitination | VVVVCNLKPVNMRGI EEEEEECCCCCCCCC | 17644757 | ||
| 286 | Phosphorylation | TAMVLCGSNDDKVEF EEEEEECCCCCCEEE | 28889911 | ||
| 290 | Acetylation | LCGSNDDKVEFVEPP EECCCCCCEEEECCC | 24489116 | ||
| 305 | Acetylation | KDSKAGDKVFFEGFG CCCCCCCEEEECCCC | 24489116 | ||
| 318 | Acetylation | FGDEAPMKQLNPKKK CCCCCCHHHCCCCHH | 24489116 | ||
| 361 | Succinylation | VRKLTNAKGESFKVA CHHHCCCCCCCEEEE | 23954790 | ||
| 366 | Acetylation | NAKGESFKVASIANA CCCCCCEEEEEEECC | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARC1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
