| UniProt ID | AMA1_YEAST | |
|---|---|---|
| UniProt AC | P50082 | |
| Protein Name | Meiosis-specific APC/C activator protein AMA1 | |
| Gene Name | AMA1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 593 | |
| Subcellular Localization | ||
| Protein Description | Activator protein that regulates the ubiquitin ligase activity and substrate specificity of the anaphase promoting complex/cyclosome (APC/C). Required for the ubiquitination and subsequent degradation of the B-type cyclin CLB1 by the APC/C complex during meiosis. Required for meiosis I, late meiotic gene expression and spore wall assembly.. | |
| Protein Sequence | MATPHLYHRYNSKSSNKNINSSGNSTEVDRFIPKSVSRNAYKSIPMLNGFDISYSELCEKSPSPERLSSPEFFNELRNTGHYESISTTNEFSMSSISSSSESQVTRSGSARASRNDYSKLTKEQKDHRKNIAHSLGFQLPDRVFTFETTSAEILEKNKAIKNCFGPGSCAEIRSTFDFSTLSPDVARYYIANSNARSASPQRQIQRPAKRVKSHIPYRVLDAPCLRNDFYSNLISWSRTTNNVLVGLGCSVYIWSEKEGAVSILDHQYLSEKRDLVTCVSFCPYNTYFIVGTKFGRILLYDQKEFFHSSNTNEKEPVFVFQTESFKGICCLEWFKPGEICKFYVGEENGNVSLFEIKSLHFPIKNWSKRQKLEDENLIGLKLHSTYQAQAQQVCGISLNEHANLLAVGGNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFWHTSTGTLLDEICTSGQVTSLIWSLRHKQIVATFGFGDTKNPVLITLYSYPKLSKLLEVRSPNPLRVLSAVISPSSMAICVATNDETIRFYELWNDKEEIINEIQESGIYGSNIIEYMEGIETTHNKRIR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MATPHLYHRYNSKS -CCCCCHHHCCCCCC | 4.92 | 28132839 | |
| 10 | Phosphorylation | TPHLYHRYNSKSSNK CCCHHHCCCCCCCCC | 15.52 | 28132839 | |
| 15 | Phosphorylation | HRYNSKSSNKNINSS HCCCCCCCCCCCCCC | 56.40 | 30377154 | |
| 69 | Phosphorylation | PSPERLSSPEFFNEL CCHHHHCCHHHHHHH | 32.80 | 27214570 | |
| 150 | Phosphorylation | VFTFETTSAEILEKN EEEEECCCHHHHHHC | 31.18 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AMA1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AMA1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AMA1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
