RFU1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RFU1_YEAST
• UniProt AC: Q08003
• Protein Name: Regulator of free ubiquitin chains 1
• Gene Name: RFU1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 200
• Subcellular Localization: Endosome .
• Protein Description: Inhibitor of the DOA4 deubiquitinase involved in the regulation of protein degradation by the proteasome and maintenance of a normal level of free ubiquitin..
• Protein Sequence: MKSSKQLVQDAKDYRFNPAIPLRIYLKTCIGILEKAQCAFQANDLSLSFIYYFRYVDLLTNKLSRHPELLRMDASSSSSSSYIHKREYLQLIKLEVPAVCKIIESLRTQIDSQYSKLQTSLANNIAKPNINANTTPVQVEQQPLPKKSFDEYSFNQSISFFQKISNAQLNTGASSQSQATARDEAYRLNYPELPRLTFST

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RFU1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RFU1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RFU1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RFU1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC48_YEAST	CDC48	genetic	19410548
RPN2_YEAST	RPN2	genetic	19410548
PRS7_YEAST	RPT1	genetic	19410548
UBP4_YEAST	DOA4	physical	19410548
BRO1_YEAST	BRO1	physical	19410548
RPN4_YEAST	RPN4	genetic	20093466
DS1P2_YEAST	YSR3	genetic	20093466
JNM1_YEAST	JNM1	genetic	20093466
INO4_YEAST	INO4	genetic	20093466
PDE2_YEAST	PDE2	genetic	20093466
BRO1_YEAST	BRO1	physical	24962567
BRO1_YEAST	BRO1	physical	26150415

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.