UniProt ID | FSH3_YEAST | |
---|---|---|
UniProt AC | Q99369 | |
Protein Name | Family of serine hydrolases 3 | |
Gene Name | FSH3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 266 | |
Subcellular Localization | ||
Protein Description | Serine hydrolase of unknown specificity.. | |
Protein Sequence | MSEKKKVLMLHGFVQSDKIFSAKTGGLRKNLKKLGYDLYYPCAPHSIDKKALFQSESEKGRDAAKEFNTSATSDEVYGWFFRNPESFNSFQIDQKVFNYLRNYVLENGPFDGVIGFSQGAGLGGYLVTDFNRILNLTDEQQPALKFFISFSGFKLEDQSYQKEYHRIIQVPSLHVRGELDEVVAESRIMALYESWPDNKRTLLVHPGAHFVPNSKPFVSQVCNWIQGITSKEGQEHNAQPEVDRKQFDKPQLEDDLLDMIDSLGKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
69 | Phosphorylation | DAAKEFNTSATSDEV HHHHHHCCCCCCCCE | 25.67 | 19823750 | |
70 | Phosphorylation | AAKEFNTSATSDEVY HHHHHCCCCCCCCEE | 30.56 | 19823750 | |
72 | Phosphorylation | KEFNTSATSDEVYGW HHHCCCCCCCCEEEE | 36.16 | 19823750 | |
73 | Phosphorylation | EFNTSATSDEVYGWF HHCCCCCCCCEEEEH | 31.33 | 19823750 | |
77 | Phosphorylation | SATSDEVYGWFFRNP CCCCCCEEEEHHCCH | 13.44 | 19823750 | |
86 | Phosphorylation | WFFRNPESFNSFQID EHHCCHHHHCCCCCC | 30.87 | 19823750 | |
89 | Phosphorylation | RNPESFNSFQIDQKV CCHHHHCCCCCCHHH | 19.27 | 19823750 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FSH3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FSH3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FSH3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CALM_YEAST | CMD1 | genetic | 27708008 | |
UAP1_YEAST | QRI1 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
PRP21_YEAST | PRP21 | genetic | 27708008 | |
MED11_YEAST | MED11 | genetic | 27708008 | |
UFE1_YEAST | UFE1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...