| UniProt ID | FSH3_YEAST | |
|---|---|---|
| UniProt AC | Q99369 | |
| Protein Name | Family of serine hydrolases 3 | |
| Gene Name | FSH3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 266 | |
| Subcellular Localization | ||
| Protein Description | Serine hydrolase of unknown specificity.. | |
| Protein Sequence | MSEKKKVLMLHGFVQSDKIFSAKTGGLRKNLKKLGYDLYYPCAPHSIDKKALFQSESEKGRDAAKEFNTSATSDEVYGWFFRNPESFNSFQIDQKVFNYLRNYVLENGPFDGVIGFSQGAGLGGYLVTDFNRILNLTDEQQPALKFFISFSGFKLEDQSYQKEYHRIIQVPSLHVRGELDEVVAESRIMALYESWPDNKRTLLVHPGAHFVPNSKPFVSQVCNWIQGITSKEGQEHNAQPEVDRKQFDKPQLEDDLLDMIDSLGKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 69 | Phosphorylation | DAAKEFNTSATSDEV HHHHHHCCCCCCCCE | 25.67 | 19823750 | |
| 70 | Phosphorylation | AAKEFNTSATSDEVY HHHHHCCCCCCCCEE | 30.56 | 19823750 | |
| 72 | Phosphorylation | KEFNTSATSDEVYGW HHHCCCCCCCCEEEE | 36.16 | 19823750 | |
| 73 | Phosphorylation | EFNTSATSDEVYGWF HHCCCCCCCCEEEEH | 31.33 | 19823750 | |
| 77 | Phosphorylation | SATSDEVYGWFFRNP CCCCCCEEEEHHCCH | 13.44 | 19823750 | |
| 86 | Phosphorylation | WFFRNPESFNSFQID EHHCCHHHHCCCCCC | 30.87 | 19823750 | |
| 89 | Phosphorylation | RNPESFNSFQIDQKV CCHHHHCCCCCCHHH | 19.27 | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FSH3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FSH3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FSH3_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CALM_YEAST | CMD1 | genetic | 27708008 | |
| UAP1_YEAST | QRI1 | genetic | 27708008 | |
| CDC37_YEAST | CDC37 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| PRP21_YEAST | PRP21 | genetic | 27708008 | |
| MED11_YEAST | MED11 | genetic | 27708008 | |
| UFE1_YEAST | UFE1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
