| UniProt ID | PEX27_YEAST | |
|---|---|---|
| UniProt AC | Q08580 | |
| Protein Name | Peroxisomal membrane protein PEX27 | |
| Gene Name | PEX27 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 376 | |
| Subcellular Localization |
Peroxisome membrane Peripheral membrane protein . |
|
| Protein Description | Required for regulation of peroxisome size and number. Also promotes peroxisome division and biogenesis.. | |
| Protein Sequence | MTSDPVNTNISSPTLTDRNADESWELLKREFNTLFSNLKTDSKEEGNFTDNKGVIAKKPIVLQDNDDSDFTQNQGKVATATSTTSDRSFKRTLGSIEMKKRYVKKNCQAKFVFNTLEGKEVCSKILQHTLGLLSLLLLTRKIRLLNFSSKLRLVIQQLSLFRYYLRFGNFAINLYKIIKRFRWLREMKKLHYKDQSILFYFKNFRFFDIIEAFYNLTDELILFHKLQSMFGKKNTSHANTNRLMTFVKEQHYILWEVLNILAINKNIEQWRQLIRDEIYLSIYNTSGNAIKEYELKYKLPTNDKVNLELRKNNITLDFYKIILNLLSNLINIKGKRDKYNSELAYEIISVGSGVTELLKLWNRAKVTSANEHTSAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | DPVNTNISSPTLTDR CCCCCCCCCCCCCCC | 32.13 | 24961812 | |
| 12 | Phosphorylation | PVNTNISSPTLTDRN CCCCCCCCCCCCCCC | 20.36 | 27214570 | |
| 14 | Phosphorylation | NTNISSPTLTDRNAD CCCCCCCCCCCCCHH | 44.21 | 24961812 | |
| 16 | Phosphorylation | NISSPTLTDRNADES CCCCCCCCCCCHHHH | 35.08 | 27214570 | |
| 68 | Phosphorylation | VLQDNDDSDFTQNQG EECCCCCCCCCCCCC | 37.17 | 22369663 | |
| 71 | Phosphorylation | DNDDSDFTQNQGKVA CCCCCCCCCCCCCEE | 31.44 | 22369663 | |
| 83 | Phosphorylation | KVATATSTTSDRSFK CEEEEECCCCCHHHH | 26.43 | 21440633 | |
| 85 | Phosphorylation | ATATSTTSDRSFKRT EEEECCCCCHHHHHH | 30.99 | 20377248 | |
| 88 | Phosphorylation | TSTTSDRSFKRTLGS ECCCCCHHHHHHHCC | 39.86 | 20377248 | |
| 228 | Phosphorylation | ILFHKLQSMFGKKNT HHHHHHHHHHCCCCC | 26.90 | 21551504 | |
| 240 | Phosphorylation | KNTSHANTNRLMTFV CCCCCCCHHHHHHHH | 23.62 | 21551504 | |
| 345 | Phosphorylation | KYNSELAYEIISVGS CCCCHHHHHHHHHCC | 21.93 | 19684113 | |
| 349 | Phosphorylation | ELAYEIISVGSGVTE HHHHHHHHHCCHHHH | 26.53 | 28889911 | |
| 352 | Phosphorylation | YEIISVGSGVTELLK HHHHHHCCHHHHHHH | 28.12 | 19684113 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX27_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX27_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX27_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PEX27_YEAST | PEX27 | physical | 14517321 | |
| PEX11_YEAST | PEX11 | genetic | 14517338 | |
| BLM10_YEAST | BLM10 | genetic | 27708008 | |
| HAP3_YEAST | HAP3 | genetic | 27708008 | |
| NU170_YEAST | NUP170 | genetic | 27708008 | |
| RS6A_YEAST | RPS6B | genetic | 27708008 | |
| RS6B_YEAST | RPS6B | genetic | 27708008 | |
| RIM1_YEAST | RIM1 | genetic | 27708008 | |
| BUD31_YEAST | BUD31 | genetic | 27708008 | |
| DBP3_YEAST | DBP3 | genetic | 27708008 | |
| PFD3_YEAST | PAC10 | genetic | 27708008 | |
| VMA21_YEAST | VMA21 | genetic | 27708008 | |
| STB5_YEAST | STB5 | genetic | 27708008 | |
| IMPX_YEAST | IMP2 | genetic | 27708008 | |
| SDHX_YEAST | YJL045W | genetic | 27708008 | |
| LPLA_YEAST | AIM22 | genetic | 27708008 | |
| ASF1_YEAST | ASF1 | genetic | 27708008 | |
| YJQ3_YEAST | YJL163C | genetic | 27708008 | |
| ILM1_YEAST | ILM1 | genetic | 27708008 | |
| RL22A_YEAST | RPL22A | genetic | 27708008 | |
| SWS2_YEAST | SWS2 | genetic | 27708008 | |
| MET22_YEAST | MET22 | genetic | 27708008 | |
| RMI1_YEAST | RMI1 | genetic | 27708008 | |
| HSP7F_YEAST | SSE1 | genetic | 27708008 | |
| YP260_YEAST | YPL260W | genetic | 27708008 | |
| QCR2_YEAST | QCR2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...