UniProt ID | PEX11_YEAST | |
---|---|---|
UniProt AC | Q12462 | |
Protein Name | Peroxisomal membrane protein PMP27 | |
Gene Name | PEX11 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 236 | |
Subcellular Localization |
Peroxisome membrane Peripheral membrane protein . |
|
Protein Description | Involved in peroxisomal proliferation. Promotes peroxisome division and biogenesis.. | |
Protein Sequence | MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRKFLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVTVLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLGKAYQDRYTALRRLFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | RFLAVQNSSLLARQL HHHHHCCHHHHHHHH | 12.79 | 27214570 | |
45 | Phosphorylation | FLAVQNSSLLARQLQ HHHHCCHHHHHHHHH | 34.65 | 27214570 | |
76 | Acetylation | NHLQAAAKFYDNKLA CHHHHHHHHHCCCCC | 39.47 | 22865919 | |
81 | Ubiquitination | AAKFYDNKLASDNVV HHHHHCCCCCCCHHH | 42.40 | 23749301 | |
149 | Ubiquitination | GLAMDLRKIQTSHAQ HHHHHHHHHHCCHHH | 46.60 | 17644757 | |
162 | Ubiquitination | AQIAAFVKAKSQSQG HHHHHHHHHHHHCCC | 43.58 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX11_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX11_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX11_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...