dbPTM

PEX11_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PEX11_YEAST
UniProt AC	Q12462
Protein Name	Peroxisomal membrane protein PMP27
Gene Name	PEX11
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	236
Subcellular Localization	Peroxisome membrane Peripheral membrane protein .
Protein Description	Involved in peroxisomal proliferation. Promotes peroxisome division and biogenesis..
Protein Sequence	MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRKFLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVTVLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLGKAYQDRYTALRRLFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	RFLAVQNSSLLARQL HHHHHCCHHHHHHHH	12.79	27214570
45	Phosphorylation	FLAVQNSSLLARQLQ HHHHCCHHHHHHHHH	34.65	27214570
76	Acetylation	NHLQAAAKFYDNKLA CHHHHHHHHHCCCCC	39.47	22865919
81	Ubiquitination	AAKFYDNKLASDNVV HHHHHCCCCCCCHHH	42.40	23749301
149	Ubiquitination	GLAMDLRKIQTSHAQ HHHHHHHHHHCCHHH	46.60	17644757
162	Ubiquitination	AQIAAFVKAKSQSQG HHHHHHHHHHHHCCC	43.58	17644757

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PEX11_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PEX11_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PEX11_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PEX11_YEAST	PEX11	physical	14517321
PEX11_YEAST	PEX11	physical	8858168
FOX2_YEAST	FOX2	physical	15596542
MASY_YEAST	MLS1	physical	15596542
MDHP_YEAST	MDH3	physical	15596542
PEX19_YEAST	PEX19	physical	15133130
PEX25_YEAST	PEX25	genetic	14517338
PEX19_YEAST	PEX19	physical	16551610
PEX19_YEAST	PEX19	physical	16520372
ANT1_YEAST	ANT1	physical	18467557
PEX25_YEAST	PEX25	physical	18467557
PEX11_YEAST	PEX11	physical	18467557
ARF3_YEAST	ARF3	physical	18467557
BBC1_YEAST	BBC1	genetic	20093466
PTK2_YEAST	PTK2	genetic	20093466
VPS13_YEAST	VPS13	genetic	20093466
PEX25_YEAST	PEX25	genetic	20093466
PEX19_YEAST	PEX19	physical	12876220
PEX11_YEAST	PEX11	physical	12876220
PEX27_YEAST	PEX27	genetic	21951626
PEX25_YEAST	PEX25	genetic	21951626
PEX19_YEAST	PEX19	physical	19451657
PEX11_YEAST	PEX11	physical	25769804
FIS1_YEAST	FIS1	physical	22337771
PEX13_YEAST	PEX13	physical	26644516
CSG2_YEAST	CSG2	genetic	27708008
PEX32_YEAST	PEX32	genetic	27708008
MBA1_YEAST	MBA1	genetic	27708008
YB75_YEAST	YBR225W	genetic	27708008
SNX41_YEAST	SNX41	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
HPM1_YEAST	HPM1	genetic	27708008
VPS13_YEAST	VPS13	genetic	27708008
RIC1_YEAST	RIC1	genetic	27708008
ACE2_YEAST	ACE2	genetic	27708008
RS3A2_YEAST	RPS1B	genetic	27708008
TMA23_YEAST	TMA23	genetic	27708008
HUB1_YEAST	HUB1	genetic	27708008
PMA2_YEAST	PMA2	genetic	27708008
PEX25_YEAST	PEX25	genetic	27708008
PEX11_YEAST	PEX11	physical	26597702

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PEX11_YEAST

Related Literatures of Post-Translational Modification