UniProt ID | ARF3_YEAST | |
---|---|---|
UniProt AC | P40994 | |
Protein Name | ADP-ribosylation factor 3 | |
Gene Name | ARF3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 183 | |
Subcellular Localization | Golgi apparatus. | |
Protein Description | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
Protein Sequence | MGNSISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWISNNTNVPKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNSISKVL ------CCCHHHHHH | 36.27 | - | |
4 | Phosphorylation | ----MGNSISKVLGK ----CCCHHHHHHHH | 23.62 | 19823750 | |
6 | Phosphorylation | --MGNSISKVLGKLF --CCCHHHHHHHHHH | 19.28 | 19823750 | |
36 | Acetylation | GKTTILYKLKLNKIK CCEEEEEEEECCCCC | 35.38 | 24489116 | |
46 | Phosphorylation | LNKIKTSTPTVGFNV CCCCCCCCCCCCEEE | 28.36 | 27214570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF3_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...