| UniProt ID | ARF3_YEAST | |
|---|---|---|
| UniProt AC | P40994 | |
| Protein Name | ADP-ribosylation factor 3 | |
| Gene Name | ARF3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 183 | |
| Subcellular Localization | Golgi apparatus. | |
| Protein Description | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.. | |
| Protein Sequence | MGNSISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWISNNTNVPKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGNSISKVL ------CCCHHHHHH | 36.27 | - | |
| 4 | Phosphorylation | ----MGNSISKVLGK ----CCCHHHHHHHH | 23.62 | 19823750 | |
| 6 | Phosphorylation | --MGNSISKVLGKLF --CCCHHHHHHHHHH | 19.28 | 19823750 | |
| 36 | Acetylation | GKTTILYKLKLNKIK CCEEEEEEEECCCCC | 35.38 | 24489116 | |
| 46 | Phosphorylation | LNKIKTSTPTVGFNV CCCCCCCCCCCCEEE | 28.36 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARF3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...