dbPTM

CDA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDA2_YEAST
UniProt AC	Q06703
Protein Name	Chitin deacetylase 2
Gene Name	CDA2
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	312
Subcellular Localization
Protein Description	Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin..
Protein Sequence	MRIQLNTIDLQCIIALSCLGQFVHAEANREDLKQIDFQFPVLERAATKTPFPDWLSAFTGLKEWPGLDPPYIPLDFIDFSQIPDYKEYDQNHCDSVPRDSCSFDCHHCTEHDDVYTCSKLSQTFDDGPSASTTKLLDRLKHNSTFFNLGVNIVQHPDIYQRMQKEGHLIGSHTWSHVYLPNVSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQAVLWDHDTFDWSLLLNDSVITEQEILQNVINWNKSGTGLILEHDSTEKTVDLAIKINKLIGDDQSTVSHCVGGIDYIKEFLS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
142	N-linked_Glycosylation	LLDRLKHNSTFFNLG HHHHHCCCCCEECCC	40.95	-
181	N-linked_Glycosylation	WSHVYLPNVSNEKII CEEEECCCCCCCCEE	47.45	-
199	N-linked_Glycosylation	EWSIWAMNATGNHTP EEEEECCCCCCCCCC	26.97	-
246	N-linked_Glycosylation	FDWSLLLNDSVITEQ CCHHHHCCCCCCCHH	39.21	-
263	N-linked_Glycosylation	LQNVINWNKSGTGLI HHHHHHCCCCCCCEE	24.91	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDA2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDA2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GET3_YEAST	GET3	genetic	20093466
OMS1_YEAST	OMS1	genetic	20093466
ASK10_YEAST	ASK10	genetic	20093466
ATG32_YEAST	ATG32	genetic	20093466
CSN11_YEAST	PCI8	genetic	20093466

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDA2_YEAST

Related Literatures of Post-Translational Modification