| UniProt ID | YPT31_YEAST | |
|---|---|---|
| UniProt AC | P38555 | |
| Protein Name | GTP-binding protein YPT31/YPT8 | |
| Gene Name | YPT31 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 223 | |
| Subcellular Localization |
Golgi apparatus membrane Lipid-anchor . |
|
| Protein Description | Required for protein transport in the secretory pathway. Probably involved in regulation of secretory vesicle formation at the trans-Golgi compartment. Plays a role in autophagy.. | |
| Protein Sequence | MSSEDYGYDYDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSANGNANGASAPNGPTISLTPTPNENKKANGNNCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSSEDYGYD ------CCHHHHCCC | 42.29 | 28152593 | |
| 2 | Acetylation | ------MSSEDYGYD ------CCHHHHCCC | 42.29 | - | |
| 3 | Phosphorylation | -----MSSEDYGYDY -----CCHHHHCCCH | 32.94 | 19823750 | |
| 26 | Ubiquitination | IGDSGVGKSNLLSRF ECCCCCCHHHHHHHH | 33.49 | 23749301 | |
| 35 | Acetylation | NLLSRFTKNEFNMDS HHHHHHCCCCCCCCC | 52.33 | 24489116 | |
| 35 | Ubiquitination | NLLSRFTKNEFNMDS HHHHHHCCCCCCCCC | 52.33 | 23749301 | |
| 44 | Phosphorylation | EFNMDSKSTIGVEFA CCCCCCCCCEEEEEC | 29.25 | 22369663 | |
| 45 | Phosphorylation | FNMDSKSTIGVEFAT CCCCCCCCEEEEECE | 26.03 | 22369663 | |
| 63 | Ubiquitination | EIDGKRIKAQIWDTA EECCEEEEEEEECCC | 37.97 | 23749301 | |
| 80 | Phosphorylation | ERYRAITSAYYRGAV HHHHHHHHHHHHCCC | 14.25 | 27214570 | |
| 127 | Ubiquitination | AVGLIGNKSDLAHLR EEEEECCHHHHHHHC | 39.88 | 24961812 | |
| 138 | Phosphorylation | AHLRAVPTEESKTFA HHHCCCCCHHHHHHH | 45.87 | 21440633 | |
| 177 | Acetylation | LINTIYQKVSKHQMD HHHHHHHHHHHHCCC | 31.35 | 24489116 | |
| 180 | Acetylation | TIYQKVSKHQMDLGD HHHHHHHHHCCCCCC | 40.62 | 24489116 | |
| 188 | Phosphorylation | HQMDLGDSSANGNAN HCCCCCCCCCCCCCC | 29.56 | 23749301 | |
| 189 | Phosphorylation | QMDLGDSSANGNANG CCCCCCCCCCCCCCC | 30.41 | 21551504 | |
| 198 | Phosphorylation | NGNANGASAPNGPTI CCCCCCCCCCCCCEE | 45.73 | 21551504 | |
| 204 | Phosphorylation | ASAPNGPTISLTPTP CCCCCCCEEECCCCC | 25.29 | 23749301 | |
| 206 | Phosphorylation | APNGPTISLTPTPNE CCCCCEEECCCCCCC | 28.77 | 24961812 | |
| 208 | Phosphorylation | NGPTISLTPTPNENK CCCEEECCCCCCCCC | 20.51 | 23749301 | |
| 210 | Phosphorylation | PTISLTPTPNENKKA CEEECCCCCCCCCCC | 33.25 | 21440633 | |
| 222 | Geranylgeranylation | KKANGNNCC------ CCCCCCCCC------ | 3.19 | - | |
| 223 | Geranylgeranylation | KANGNNCC------- CCCCCCCC------- | 7.31 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPT31_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPT31_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPT31_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44 AND THR-45, AND MASSSPECTROMETRY. | |
