| UniProt ID | DGK1_YEAST | |
|---|---|---|
| UniProt AC | Q12382 | |
| Protein Name | CTP-dependent diacylglycerol kinase 1 | |
| Gene Name | DGK1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 290 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. Nucleus membrane Multi-pass membrane protein. |
|
| Protein Description | Involved in pre-tRNA splicing (By similarity). CTP-dependent diacylglycerol kinase that catalyzes the phosphorylation of diacylglycerol (DAG) to phosphatidate (PA). Controls phosphatidate levels at the nuclear envelope. Counteracts the activity of PAH1/SMP2. Involved in the resistance to nickel chloride and nalidixic acid. May be involved in vesicle trafficking between the endoplasmic reticulum and the Golgi apparatus.. | |
| Protein Sequence | MGTEDAIALPNSTLEPRTEAKQRLSSKSHQVSAKVTIPAKEEISSSDDDAHVPVTEIHLKSHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQGINYKNVLWPLIYAFIILFILDLIRLNWPFFNMLYCRTVGALMRKKEIHTYNGVLWYILGLIFSFNFFSKDVTLISLFLLSWSDTAAATIGRKYGHLTPKVARNKSLAGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPETSRLSLNMLSLLGGVVAALSEGIDLFNWDDNFTIPVLSSLFMNAVIKTFKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MGTEDAIALP -----CCHHHCCCCC | 29.41 | 27214570 | |
| 11 | N-linked_Glycosylation | EDAIALPNSTLEPRT HHCCCCCCCCCCCCC | 48.77 | - | |
| 26 | Phosphorylation | EAKQRLSSKSHQVSA HHHHHHHCCCCCCEE | 42.65 | 23749301 | |
| 36 | Phosphorylation | HQVSAKVTIPAKEEI CCCEEEEEECCCHHH | 22.12 | 19795423 | |
| 44 | Phosphorylation | IPAKEEISSSDDDAH ECCCHHHCCCCCCCC | 27.37 | 22369663 | |
| 45 | Phosphorylation | PAKEEISSSDDDAHV CCCHHHCCCCCCCCC | 43.37 | 22369663 | |
| 46 | Phosphorylation | AKEEISSSDDDAHVP CCHHHCCCCCCCCCC | 37.96 | 22369663 | |
| 55 | Phosphorylation | DDAHVPVTEIHLKSH CCCCCCCEEEEECCC | 24.13 | 22369663 | |
| 71 | Acetylation | WFGDFITKHEIPRKV CHHHHHHHCCCCHHH | 34.13 | 24489116 | |
| 81 | Phosphorylation | IPRKVFHSSIGFITL CCHHHHHCCHHHHHH | 16.52 | 23607784 | |
| 82 | Phosphorylation | PRKVFHSSIGFITLY CHHHHHCCHHHHHHH | 20.40 | 23607784 | |
| 87 | Phosphorylation | HSSIGFITLYLYTQG HCCHHHHHHHHHHCC | 13.69 | 23607784 | |
| 89 | Phosphorylation | SIGFITLYLYTQGIN CHHHHHHHHHHCCCC | 6.76 | 23607784 | |
| 91 | Phosphorylation | GFITLYLYTQGINYK HHHHHHHHHCCCCHH | 5.40 | 23607784 | |
| 92 | Phosphorylation | FITLYLYTQGINYKN HHHHHHHHCCCCHHH | 20.09 | 23607784 | |
| 97 | Phosphorylation | LYTQGINYKNVLWPL HHHCCCCHHHCHHHH | 11.30 | 23607784 | |
| 197 | N-linked_Glycosylation | LTPKVARNKSLAGSI CCHHHHCCCHHHHHH | 28.64 | - | |
| 270 | N-linked_Glycosylation | DLFNWDDNFTIPVLS CCCCCCCCCHHHHHH | 33.22 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DGK1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DGK1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
