FUN14_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FUN14_YEAST
• UniProt AC: P18411
• Protein Name: Protein FUN14
• Gene Name: FUN14
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 198
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MTLAFNMQRLVFRNLNVGKRMFKNVPLWRFNVANKLGKPLTRSVGLGGAGIVAGGFYLMNRQPSKLIFNDSLGAAVKQQGPLEPTVGNSTAITEERRNKISSHKQMFLGSLFGVVLGVTVAKISILFMYVGITSMLLCEWLRYKGWIRINLKNIKSVIVLKDVDLKKLLIDGLLGTEYMGFKVFFTLSFVLASLNANK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
101	Phosphorylation	EERRNKISSHKQMFL HHHHHHCHHCHHHHH	28.18	28889911
119	Phosphorylation	FGVVLGVTVAKISIL HHHHHHHHHHHHHHH	16.98	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FUN14_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FUN14_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FUN14_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UIP4_YEAST	UIP4	physical	18467557
ALO_YEAST	ALO1	physical	18467557
FABG_YEAST	OAR1	genetic	27708008
NEM1_YEAST	NEM1	genetic	27708008
APC9_YEAST	APC9	genetic	27708008
YL413_YEAST	INA1	genetic	27708008
ATP23_YEAST	ATP23	genetic	27708008
SUCA_YEAST	LSC1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.