UniProt ID | FUN14_YEAST | |
---|---|---|
UniProt AC | P18411 | |
Protein Name | Protein FUN14 | |
Gene Name | FUN14 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 198 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MTLAFNMQRLVFRNLNVGKRMFKNVPLWRFNVANKLGKPLTRSVGLGGAGIVAGGFYLMNRQPSKLIFNDSLGAAVKQQGPLEPTVGNSTAITEERRNKISSHKQMFLGSLFGVVLGVTVAKISILFMYVGITSMLLCEWLRYKGWIRINLKNIKSVIVLKDVDLKKLLIDGLLGTEYMGFKVFFTLSFVLASLNANK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FUN14_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FUN14_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FUN14_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UIP4_YEAST | UIP4 | physical | 18467557 | |
ALO_YEAST | ALO1 | physical | 18467557 | |
FABG_YEAST | OAR1 | genetic | 27708008 | |
NEM1_YEAST | NEM1 | genetic | 27708008 | |
APC9_YEAST | APC9 | genetic | 27708008 | |
YL413_YEAST | INA1 | genetic | 27708008 | |
ATP23_YEAST | ATP23 | genetic | 27708008 | |
SUCA_YEAST | LSC1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...